KEGG   Sphaerochaeta pleomorpha: SpiGrapes_1385Help
Entry
SpiGrapes_1385    CDS       T01673                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SpiGrapes_1385
  Lipid metabolism
   00561 Glycerolipid metabolism
    SpiGrapes_1385
   00600 Sphingolipid metabolism
    SpiGrapes_1385
Enzymes [BR:sgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SpiGrapes_1385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1495612..1497969
Genome map
AA seq 785 aa AA seqDB search
MITKKDQCFYLSTKNTTYLFSVTETGHLEHLYYGKTIAPDSINLEALSEKRSLPIGTGTA
YDNAHKTLFLGNLCLEYSTMGKGDCRESSVDIEYGRGMHTLDFTVKDFRILQGKPRTFGG
LAESYGDKETCTTLEITLKDTCLPIRLALSYTAFEDSDVITRRSTLFNDSDRTITIRNLA
SLQLDLDEDDWNFVTFDGAWSRERYQHERPLMPGIMINDSKTGVSSAEHNPCVFLTKQGS
TPSNGECIGCNLVYSGNHRELVETSPYGKVRLLTGINPATFSWELSSQDRFQSPEAVLTF
SSLGMNGASNNFHHFINNHIVRGPWKFRERPVLVNNWEATYFNFSEDKLIALAKQSAELG
AELFVLDDGWFGIRNDDTTSLGDWTVNPKKLPSGLSRLSLEIHRLGMMFGLWVEPEMISV
ESELYKKHPDWMVAIPGRTPSVGRNQHLLDLTRLDVREYLFKILSDTWHLADVNYIKWDM
NRTFSDLYSANSEIHNHGEFIHRYVLGLYELLSRLTAAFPNVLFESCASGGNRFDLGMLC
FMPQTWTSDNTDALCRLYIQEGTSCGYPLSTMGSHVSASPNHQTLRKTDLDSRFNIAAFG
VLGYELDITKLTRQQKEAVKAQISFYKAHRAILQFGTFNRIKLANSSSNQVVWLVHNADK
SELLVLFAQKLNPSNPGTDKLRIEGAHLEAIYEVFPRQQKIDLKSIGDLINQISPFAISE
GSKTQDALSNAVSLDSEIEHYRVSGELLANAGIKLNQQFGGTGYNAETRVLGDFGSRLYI
FKRIN
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgataaccaagaaggaccaatgcttctatctttctaccaaaaatacaacctatttattc
tccgtcacagagacaggacatctagagcacctctattatggaaaaacaattgcaccagat
tctatcaacctggaagcactcagtgaaaaacgatcgctcccgatcggaaccggtacagcc
tatgacaacgcccataaaaccctttttcttggcaacctctgccttgagtattctaccatg
ggaaagggcgattgcagagaaagttcggtagatattgaatatggacggggaatgcacacc
ctcgatttcacagtcaaggacttcaggatcctgcagggaaagccaagaaccttcgggggc
cttgccgagtcctatggggacaaggaaacctgcaccacccttgaaataacacttaaggac
acctgcctgcccatacgccttgccctctcctacaccgccttcgaagactccgatgtcata
accaggcgatcaaccctcttcaacgacagcgacagaactatcaccatacgcaacctggct
tccctgcagctcgatctcgatgaggatgactggaatttcgtcaccttcgatggcgcctgg
tcaagggagcgctatcagcatgagagacctttgatgcctggtatcatgatcaacgatagc
aagacaggggtcagctctgcagagcacaacccctgtgttttccttaccaaacagggaagc
accccttcaaacggagaatgcataggttgcaacctcgtctacagcggaaaccatagggaa
ctggtagaaacctccccctatgggaaagtcaggcttttgaccggcatcaacccagcgacc
ttcagctgggagctttccagccaggacaggttccagagtcccgaggctgtgttaaccttc
tcgtccttgggaatgaacggggcaagcaacaacttccatcactttatcaacaaccatatc
gtcaggggaccttggaaattcagggaaagacccgtattggtaaacaactgggaagctact
tatttcaatttctccgaagacaaactcatcgcccttgcaaaacaatcggcagagctcggg
gcagaactcttcgtcctcgatgacggctggttcggtatccgcaacgacgataccactagc
ctcggggactggacggtcaacccaaagaaactgccttccggcctttccaggctgtcgctt
gaaatacaccgtctgggtatgatgttcggcctctgggttgaaccggaaatgatcagcgtt
gaaagcgaactctacaagaaacaccccgactggatggtagccatcccggggcgcactccc
agtgtcggaagaaaccaacacctcctcgaccttacccggcttgacgttagggaatacctg
ttcaaaatactttcagacacctggcacctggccgatgtaaactatatcaagtgggatatg
aacagaaccttctccgacctgtatagtgcaaacagcgaaatccacaaccacggggaattc
atccatcgctacgtccttggcctgtatgaattgctttcccgcctgacagccgcattcccc
aatgtactgtttgagtcgtgtgcaagcggcggaaaccgtttcgacctcggcatgctgtgc
tttatgccgcagacctggaccagtgacaataccgatgccctttgccggctctacatccag
gaaggaacctcctgcggatatcctctctctacaatggggtcgcatgtaagtgcttcaccc
aaccaccaaacccttcgaaagaccgatttagattcacggttcaacatagcggcctttgga
gtcctaggatacgaacttgacataaccaagcttacccgccaacagaaagaagcggtcaag
gcccagatttctttttacaaagcccaccgggcaattttgcagttcggtacctttaaccgg
ataaaactggcaaacagcagttccaaccaggtggtatggctcgtgcacaacgctgacaaa
tcggaactattggtgctttttgcccagaaactgaatccgagcaacccgggaacggataaa
cttcgcattgaaggtgctcatctcgaagctatatatgaagtcttcccacggcagcagaaa
attgacctgaaatcaatcggggaccttatcaaccagataagcccctttgccatcagcgag
ggaagcaaaacccaggatgctctcagtaatgccgtctccctggacagcgaaatcgaacat
tacagggttagcggggaattgttggctaatgcagggatcaagctgaaccaacagttcggc
ggaaccggatataatgcagaaacccgtgtcctcggtgatttcgggagtcggctctacatc
tttaaaaggatcaactag

DBGET integrated database retrieval system