KEGG   Sphaerochaeta pleomorpha: SpiGrapes_1560Help
Entry
SpiGrapes_1560    CDS       T01673                                 

Definition
phosphoenolpyruvate phosphomutase
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    SpiGrapes_1560
Enzymes [BR:sgp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     SpiGrapes_1560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1688752..1690050)
Genome map
AA seq 432 aa AA seqDB search
MKKVYVAMSADIIHVGHVNLLNKASELGELYVGVLTDEAIAEYKRYPLMPLEQRMGIIGS
LKGVDHVLVQETLDYEKNLREVKPDYVVHGDDWRTGVQSTMREKVIALLGEWGGELVEYP
YTAGVSIEQLRGKIDSQGVLPETRRSRLSNLLRIKKVVRVLEAHNGLSGLIVENTRVVKG
DRLEGFDAMWVSSLCDSTAKGKPDIELVDMSSRLDTINQIMEVTTKPIILDGDTGGLLEH
FVFNVKTLERIGVSAVIIEDKIGLKRNSLFGNEVAQQQDSIENFCRKITAGKQAQQTKDF
MIIARIESLILEQGMEDALKRAGAYVRAGADAVMIHSRKKDPAEIFEFCDTFGMQFPHVP
IVVVPSSFNSVYEEELAKHNVRVVIYANHLIRSAFPAMQRTAQLILENGRCKEASENCMS
IKDIITLIPGAE
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtatatgtagcgatgagtgccgacatcatccatgttggacatgtcaacttg
ctgaacaaggcaagcgaactcggggaactgtatgtgggggtccttaccgacgaagctatc
gccgaatacaaacgctatccgctgatgcccttagagcagcgtatggggattatagggtct
cttaagggtgttgaccatgtcctggtccaggaaacgctggactatgagaagaacctgagg
gaggtcaaacccgactacgtggtgcacggggatgactggaggaccggggtccagagcacg
atgcgggaaaaagtcatcgccctgctcggtgaatggggcggggaactggtggaatacccc
tatactgcaggggtgagtattgagcagctgaggggcaagattgactcccaaggtgtcctg
cccgaaaccaggcggagccgtctttccaacctgttgaggatcaagaaggttgtcagagtg
cttgaggcccacaacgggctttccggcctcatcgtggagaatacgcgggttgtcaaggga
gacaggctggaagggttcgatgccatgtgggtttcctctctctgcgactcaacggccaag
ggtaagccggacatcgagctagtcgacatgtcctcccgcctcgataccatcaaccagatc
atggaagtgacgaccaagcccatcatccttgacggcgataccggcggattgctcgagcat
ttcgtgttcaacgtgaagacgctggagcgcatcggggtgtccgctgtcattattgaggac
aagatagggctcaagaggaattccctgttcggtaacgaggttgcccagcaacaggattcc
atagagaatttctgccggaagataaccgcgggcaaacaggcccagcagacgaaggatttc
atgatcattgcccgtatcgagagcctgatcctcgaacaggggatggaggacgccttgaaa
cgggcgggtgcctacgtccgtgcaggtgccgacgcggttatgatccatagccggaagaaa
gaccctgcggagatattcgagttctgcgatacctttgggatgcaattcccccatgtcccc
atagtggttgttccctcttctttcaatagcgtctacgaggaagagctggccaaacataac
gtacgcgtggtcatctatgccaaccatctcatccgtagtgcctttcctgcaatgcagcgt
accgcccagttgatactggaaaacggaaggtgcaaggaagcgagcgagaactgtatgtcg
atcaaggatatcatcacattgatacccggtgcagaatag

DBGET integrated database retrieval system