KEGG   Sphaerochaeta pleomorpha: SpiGrapes_1596Help
Entry
SpiGrapes_1596    CDS       T01673                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SpiGrapes_1596
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpiGrapes_1596
   00052 Galactose metabolism
    SpiGrapes_1596
   00500 Starch and sucrose metabolism
    SpiGrapes_1596
   00520 Amino sugar and nucleotide sugar metabolism
    SpiGrapes_1596
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SpiGrapes_1596
   00524 Butirosin and neomycin biosynthesis
    SpiGrapes_1596
Enzymes [BR:sgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SpiGrapes_1596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1737859..1738749
Genome map
AA seq 296 aa AA seqDB search
MNTSNDSCILALDAGGTTIKLGVVLKSGGCSELVDFQETPIQSSGSIGEIEEGYAKAIET
GLSLASRHHLKLSGIAVSTPGPFDYETGISRMTHKYAAIYGQSVKKIIEQTTKDIPVRFM
HDSSAFLLGEILDPRYRSFHTPAAIIIGTGLGFAIIKQGKLLLNASQGPGISIFRRPYKG
KTAEDFVSKRGIMNLYTELGGSLCKTVREIDLEARKGDELCKKVFVQTGMHVGHIVAPLI
QEQGIDCLILGGQIAKADRLLITPLSETLQTYSIDCFVCKAQTIDTAPLVGAAQLF
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacacatcgaacgatagctgtattttggcactggatgccggagggacaacaatcaag
ctaggggtagtattgaaatccgggggctgttcagaacttgttgattttcaagaaactccg
atacagtcctctggttcgataggcgaaatcgaagaagggtatgcaaaagccatcgaaact
gggctgagcctcgcgtcccggcatcacctgaaactttccgggattgcggtgagcactccc
ggacctttcgactacgaaacgggaatcagccgcatgacccataagtatgcagctatatac
gggcaatctgtgaagaaaatcatagagcagacaaccaaggatatccctgtccgtttcatg
catgattcttcggctttcctccttggggagatacttgaccctcggtaccgctctttccat
actcccgctgcaattataatcggaaccggtttgggattcgctatcatcaaacaaggaaag
cttctgttgaatgcgtcccaaggacccgggattagtattttcaggcggccttataaagga
aaaaccgcagaggatttcgtttcgaaacggggaatcatgaacctgtacaccgaactggga
ggaagtctttgtaaaactgtcagggaaatagaccttgaagcgagaaagggagatgaactc
tgcaaaaaggtgttcgtgcaaaccggaatgcacgtaggccatattgtggctcccttgata
caggaacaaggcatcgattgccttatcctcgggggacagattgcaaaagcggacaggctg
ctcattacgccactatctgagactttgcaaacatactcaattgattgttttgtctgtaag
gcacaaactattgacacagcacctttagtaggcgcagcacaactcttctaa

DBGET integrated database retrieval system