KEGG   Sphaerochaeta pleomorpha: SpiGrapes_1745Help
Entry
SpiGrapes_1745    CDS       T01673                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SpiGrapes_1745
Enzymes [BR:sgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SpiGrapes_1745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1901834..1902766
Genome map
AA seq 310 aa AA seqDB search
MEKIAVIGSYVADIMARTPHIPALGETVKGSFFRIGAGGKGFNQAIAAAKSGNIPLFVTK
IGDDHFGAMALQMLQENGIDPADSIVDPAEDTGIALISVDEQSGQNEIIVVPGASGTFTK
KDTAKIAACLAGFSYLLVQLEINIEATLDLVEQAKEMCIKTILNPAPVQEIPDSLYKGLF
LISPNEVEAQQLSGLPYRSDADCTPIAEFFFSKGVQNVVITLGKRGAYLNTGKDEYFIDN
YKVPVVDTTGAGDAFNGGLLSGLSKGMDLVNAFNYANVVANLSITKTGTSNAMPNKQDID
RFLLEHAIVL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatagctgtcattggaagttatgttgccgatatcatggcacgcacaccccat
atccctgccttgggtgaaaccgtaaagggttcatttttccgcataggtgcaggaggcaag
ggattcaaccaagcgatagctgcggcaaaatccggcaatattccgctgttcgttacaaaa
atcggggatgatcatttcggggctatggctctgcagatgttgcaggaaaatggtatcgac
cctgctgatagtatcgtagacccggctgaagatacagggattgcacttatctctgtcgat
gaacaatcaggacagaatgaaataatcgtagttccgggtgcttccggtacgtttaccaag
aaagatactgcaaagattgctgcctgccttgctggattttcttatctccttgtccaattg
gagataaatatcgaggccaccctcgacttggttgaacaggcaaaggaaatgtgtataaaa
acaatcctgaaccctgccccagtccaagaaattcccgattccctctataaaggcctgttt
ctgatttctcccaatgaagtggaagcccagcaattatcaggccttccctaccgaagtgat
gccgactgtaccccgattgcagagttcttcttttcaaaaggcgtacaaaacgtagtcatt
acgcttggtaaaaggggagcttatctgaacacagggaaagacgaatacttcatcgataac
tacaaagttcctgtagtcgatacgacaggggccggagatgccttcaatggtggcttgcta
tcaggcttgagcaagggtatggacctagtcaatgcttttaactatgcaaatgtcgttgct
aatctctcaatcacaaaaacaggcacgagcaatgcaatgccaaacaagcaggatatcgac
aggtttctcctggaacatgcaattgtgctgtaa

DBGET integrated database retrieval system