KEGG   Sphaerochaeta pleomorpha Grapes: SpiGrapes_1836Help
Entry
SpiGrapes_1836    CDS       T01673                                 

Definition
glycosidase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sgp  Sphaerochaeta pleomorpha Grapes
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sgp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2007969..2009732)
Genome map
AA seq 587 aa AA seqDB search
MNEASLKNGIRSSLEEIYGKQVAKTWTNRFFLCIKKYLPKDNSFINHPASRLEKHYSLLI
TYGDSIQSPHCAPLVVLHEFLRKWVGDAVSTIHLLPFYPSSSDDGFSVIDPFSVDTGLGT
WDHINDLQAFYALMFDFVANHLSRSNIWIRECFAGNPEYKDFAIFLEGTEDLTQVFRPRN
LPLITQVDTDRGKRYVWTTFSKDQVDVNYHNPEVLYCMMDVLLAYVLQRGASIIRLDAVA
YLWKEIGTNCIHHEKTHAIVRLFCWLTKNLTKQSFIITETNVPHNENVAYFGDGSDEATL
VYNFSLPPLVFHTFLSQDASVLGAWAKTLVLPSSSVAFFNFLASHDGIGLMPVKNLLSDG
DVEKMCLHTVKQGGFVSRRSKGDGTESPYELNINYLSALSGFTENEPRSLLVSRFKAATA
IMVFLKGIPGIYINSLIGSQNWYGDPELTLYPRRINREKVSFKTLSKELDDPNSLRSAVL
GFHVELLRVRKREPAFSPSSEQRILALTNSACFVFLRGSSDDSDKILVLINVTPHLQRIS
IEEVWSKLDCPFPFDACIDLLEKPITITAKELVLNPYQVQLLKTKPF
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagcctccctcaaaaacggtattcgtagcagtcttgaggaaatttacggtaag
caggttgccaaaacttggacaaataggtttttcctatgtattaaaaaatacctgccaaaa
gataatagctttataaatcatcctgcctcgaggttggaaaaacattattctctattgata
acctatggggattcaatacagagtccccattgtgctcctctagttgtgttgcacgaattc
ttgagaaaatgggttggcgatgctgtttcaactattcatctgcttcctttttatccctca
tcctctgatgatgggttttctgtcattgaccccttttcggtcgatacaggactgggaacc
tgggatcatatcaatgatttgcaagctttttatgcacttatgtttgatttcgttgcaaac
catctttcccgttcgaatatctggatcagggaatgttttgcaggtaatcccgaatataag
gattttgcaatttttctcgagggaactgaagatctcacgcaggtgttcaggcctaggaat
ctacccctgataacccaagtcgacaccgataggggaaaacggtatgtctggactaccttc
agcaaagaccaggtggatgtcaattatcataaccctgaggttctgtactgtatgatggat
gttctgcttgcttatgtattgcagaggggtgcctcgattattcggcttgatgccgtggct
tacctatggaaagaaataggaacgaattgtatccatcatgaaaagacccacgctatagtc
aggcttttctgttggctgaccaagaaccttaccaagcaaagttttattattaccgaaacc
aatgttccccataacgaaaacgtagcatattttggagacggtagtgatgaggctaccctg
gtatacaacttttccctgcccccccttgttttccacacctttctttcccaggatgcttcg
gttttaggtgcttgggccaagacgcttgtgctcccttcttcttccgttgcattctttaat
tttcttgcttctcatgatgggattggactgatgccagtgaaaaacctcctttccgatggg
gatgttgaaaaaatgtgtttgcatactgtcaaacaaggaggatttgtctcacgcagaagc
aaaggtgatggaacggaaagtccgtacgaattgaatatcaattatctatccgccctttct
ggttttaccgagaacgaacctcgttccctgctggtttcccgattcaaggcagcgactgcg
atcatggtttttctcaaggggatacccggaatctatatcaatagtctgataggttcgcag
aattggtatggggatcctgagcttactttgtatcctcgaaggattaatagagagaaggta
tcctttaaaaccttgtcaaaggaattggatgatcccaattctttgagaagtgctgtcctt
ggttttcatgtggaattgcttcgggtcagaaaaagggaacctgctttttccccttcctct
gagcaaagaatcttagccctgacgaattctgcttgttttgtatttctgagaggatcctct
gatgattccgataaaatccttgttctcataaatgttactccccatttacagaggatttcg
attgaagaagtctggagcaaattggattgcccgttcccctttgatgcttgtatcgatctt
ttggaaaaacctataaccattacagcaaaggaactggtgctaaacccctatcaggtacaa
cttttgaaaaccaagcctttttaa

DBGET integrated database retrieval system