KEGG   Sphaerochaeta pleomorpha: SpiGrapes_1856Help
Entry
SpiGrapes_1856    CDS       T01673                                 

Definition
pectin methylesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SpiGrapes_1856
   00500 Starch and sucrose metabolism
    SpiGrapes_1856
Enzymes [BR:sgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     SpiGrapes_1856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2033212..2034195)
Genome map
AA seq 327 aa AA seqDB search
MEAQLITIGPDGEFRTIQEGLDAKKGELSPLVFFLQPGVYREKLYIDHPDVTIRGDSEDT
TSIVYGDSASSLCGGVPMGTFASATVTVSAPGFRAEHITIANDFDYPMHRKESDRDFGKI
TGLQAVALRTTGFSDCVYLSHCRFLGYQDTLFLDHGSHQIDSCTIEGLVDFIFGSGSCLF
LHCLVVSRGKGYICAPSTKSGDLGFLFYCCRFVCADTGVPLSSVYLGRPWHPKADPSLVP
CAVLVDCFLDGHICFEGWTSMHANCADGSQIEFTPSQSKFFESHSYGPGSVASPIPPRVS
IAKEQLPSVLGLQSPYWISLCKRLKVF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagcacaattgattaccatcgggccagatggagagttcagaaccatacaagagggc
ctcgatgcaaagaaaggggagttgtccccgttggttttttttctccaaccaggggtttac
cgtgaaaaattgtatattgatcacccagatgtaacaatcaggggcgattcagaggataca
accagcattgtgtacggcgatagtgcttcctctctttgtggtggggtgcccatgggcact
tttgcaagtgcaaccgtaacagtatcagcacctggctttcgtgccgagcatattacgatt
gccaatgacttcgattatcccatgcacaggaaagaaagcgatagggattttggaaaaatc
acagggttgcaggctgttgcgctacgaacgacaggcttttctgactgtgtatacctttcc
cattgtcggtttctggggtatcaggatactttgttccttgaccatgggtcgcatcaaatc
gattcctgtaccattgaaggactggttgatttcatttttggttctggaagctgcctgttt
ctccattgtttggttgtctcaagggggaaaggctatatctgcgctccctccacaaaaagc
ggtgatctgggttttctgttttattgctgtcggttcgtatgtgccgatacaggggttccc
ctttcttctgtctacctgggaaggccttggcatcccaaggcagacccttccctggttccc
tgtgcagttcttgttgattgctttctcgatggacacatctgctttgaaggttggacttcg
atgcatgcaaactgtgcagacggaagccagatagagtttacgccaagtcagtcaaaattc
tttgaatcgcacagttatggtcctggatctgttgcctctccgattccacctcgagtatcg
attgccaaagaacagttgccatctgttttgggcctgcagtctccttattggatttcctta
tgtaaaagattgaaggtattttga

DBGET integrated database retrieval system