KEGG   Sphaerochaeta pleomorpha Grapes: SpiGrapes_1962Help
Entry
SpiGrapes_1962    CDS       T01673                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sgp  Sphaerochaeta pleomorpha Grapes
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sgp00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:sgp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2157724..2159211
Genome map
AA seq 495 aa AA seqDB search
MKKRFVSLMVLLLCVLSLVGAEGTKEQSTQTMQGFGSSERPKYVFMFIGDGMSHVQINAA
QVFNGNNTKGDIALSPLSFTQFPVLGLQTTYDATSFCPDSASTATSLSSGIKTHSGVLGM
GVDKTTKAENIAEKLKSQKDWKIGIVSTVTLNHATPAAYYAHSPSRNNYYDIGLQLIGSG
FDYFAGGSINKATDKGQASIYDLAKANGYTFVDTKEAIEALDANSGKVYAQSPRLQDGGS
MPYSIDTDDRDVSLAGFVQKGIDVLDNEKGFFMMVESGKIDWACHANDAAAEISDILAFD
DAVKVAIDFAQKHPNETLIVVTGDHETGGMTIGYASTGYNTAFEILKNQKLSYVAFDEII
KGMKSANANLSFDEVMELVTKDFGLVAPNANATDKALVLTEVEYARLQEAFHQSMLPSDK
RTKDDVTALLYGGYDPLSVTVTHILNNKAGIGWTSYSHTGTPISVYAKGVGEQLFSGSYD
NTDIFHKLRDIVGVN
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagatttgtatcgctaatggttcttttgctgtgtgttctttccttggtaggc
gctgaggggactaaagaacaatcgactcaaacaatgcaaggcttcggctcttctgaacgt
cccaaatatgtattcatgtttatcggtgatggtatgagccatgtccagatcaatgctgcc
caggtgttcaatggcaataacacaaaaggcgatattgcccttagccccctgagtttcacc
cagtttcctgtcttggggttgcagactacctatgatgcaacttccttctgtcccgattct
gcctccacggctacttcgctttccagtggtatcaaaacccatagcggagtacttgggatg
ggagtcgataaaacgacgaaggcagagaatatcgcagagaagctcaagagtcagaaagac
tggaagattgggattgtctctaccgtcactctcaaccatgcaacccctgctgcctactat
gcccattccccttcaaggaacaactattatgatatcggcctccagctgataggtagcggt
ttcgattattttgccggtggttcgatcaataaagccactgacaagggacaggccagtatc
tacgaccttgccaaggcaaacggctatacctttgtcgatacaaaagaagccatcgaggcc
ttggatgcaaacagtggaaaagtatatgcccagagtcctcgcttgcaagatggtggttcg
atgccctattcgatcgatactgatgatagggatgtatcacttgcaggattcgttcagaag
ggcattgacgtccttgacaatgaaaaaggctttttcatgatggttgagtcaggaaaaatt
gactgggcttgtcatgccaatgatgcagctgccgagatttcagacatcctcgccttcgat
gacgcagtcaaggttgcgatcgattttgcccagaagcatcccaacgagaccttgatagta
gtcaccggtgaccatgagactggtggaatgaccattggttatgcttccaccgggtataac
accgcgtttgaaattctcaagaaccagaaactctcctatgttgcctttgacgaaatcata
aagggaatgaagagtgcaaacgcaaatctgagcttcgacgaggtaatggaacttgtgacc
aaggactttggtttggtagcaccgaatgcaaatgcaaccgacaaagccttggtccttact
gaggtggagtatgcacggttgcaggaagctttccaccagtccatgcttccttccgataag
aggaccaaagatgatgtcacggctcttctgtacggtggctatgatcccctttcggtcact
gtcacccatatcctgaacaacaaggcaggtatcggttggacgagttactcacacacgggt
acccccatatctgtctatgcaaagggagtaggcgagcagttattctctgggtcttatgat
aatacagatatctttcacaagttacgcgatattgtaggtgtgaattag

DBGET integrated database retrieval system