KEGG   Sphaerochaeta pleomorpha: SpiGrapes_2201Help
Entry
SpiGrapes_2201    CDS       T01673                                 

Definition
aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SpiGrapes_2201
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SpiGrapes_2201
Enzymes [BR:sgp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     SpiGrapes_2201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2402236..2404014
Genome map
AA seq 592 aa AA seqDB search
MDTFYCMEQKQHMAFPYRQRFILLVDVGQETWEKIPLSESESKTMLGGRLLALGLWDKYA
EYENLGSQAYESGNPIVIAAGSASDISLACCDSFTLVTRSQLTGQLSVNTSNGPLARALH
GCGYSAMVIVGRFRRLSGFEIDFNSVQFSNAEKFHDFTTKEVATHFLGKNLIALGPAGEH
QVPYASIWSDGTNFGRGGVGTVFGLKNIKYITLAPSVSGRESYDPKQLGTTIQKYQRTLQ
KSKVGDLIAKEGSVTLIEQANRYGWAAVDCFSLRRDGRLWGLSSYRDFKAADPAVQGCAG
CPNGCAHSSGEGSVFPDFSMGLALGANLELFDYQSVSLLMDRCSETGLDYYSIGAVLAWA
RKTRPEGTLSFLPDLSRATVHQYLHLIDAMAYRKGTGEQLSHTLDKLVTLYGGAEYAYAV
NSIPLAPYDLRALPAQALLTALGDDTVVIRELLSGNHYRRGKERQIAMWAMFSQDLRYAM
ESLGLCYFFSLPCFDKPFLWYPFRFYRKSMFSFFAELVSVTEGYTVTGKQVASYGRDAWA
LQRKIDKMLLKGEPVGTLPDQVLVNASSNFPAAQVVPLARLLDTYYQMRGIK
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggatacattttactgcatggaacaaaagcaacatatggcgtttccttatcgccagcgc
ttcatcttgctggttgatgttggacaggaaacctgggaaaaaatccccctatcagagagt
gaatccaaaacaatgctgggtggaaggttgcttgcgctcggactctgggacaaatatgcc
gaatacgagaatcttggaagccaagcctatgaaagtggtaatccgattgttatagctgcc
ggttcagcctcagatatttcgttggcatgttgcgattcctttaccttggtgacccgttct
cagctaaccggacagctttctgtcaatacaagcaatggcccccttgcccgggccctgcat
gggtgcggttattctgctatggtcatcgtcgggcgttttcggagactgtctgggtttgag
atagattttaattccgtacagttttccaatgcggaaaaattccacgattttacaaccaag
gaagtagcaacacactttttgggaaaaaatctgatagcgcttggacccgctggggaacat
caggtaccgtatgcttcgatctggtccgatggtacgaattttggccgcgggggtgtcgga
actgttttcggcttgaaaaatatcaagtatatcacccttgccccctcggtatcggggcgc
gagtcctacgacccgaaacaacttgggacaactattcagaaatatcaacgtaccctgcaa
aaaagcaaagtaggcgatttgatagccaaggaaggctctgttacccttatagagcaagca
aatcgctatggatgggctgctgttgattgtttttcgcttagaagagacggccggctttgg
ggcctttcctcctaccgggacttcaaggccgcggaccctgcagtgcaggggtgtgccggt
tgtccgaatggctgtgcccattcttccggggaaggttcggttttcccggatttttcaatg
gggttggcccttggtgccaatcttgagcttttcgattaccaaagtgtttcccttcttatg
gatcgttgctcggaaaccggtctggattattattcgataggggcagtccttgcctgggcg
cgaaagaccagacctgaagggacactctcgttccttcctgatctcagtcgtgcaacagtc
catcaataccttcatcttatcgatgcaatggcctacagaaagggtactggggaacaactg
tcccataccttggacaaactggttacactatacggtggtgccgaatacgcctatgccgtg
aactctattccccttgctccctatgacttgagggccttgccggcccaggcactgctcact
gcgcttggtgatgacacggttgtaatcagggagttgttgtcaggcaaccattacaggaga
ggaaaagagcgccagattgcaatgtgggcaatgttttcgcaagacctccggtatgcaatg
gagtcgctaggcctttgttattttttctccctgccctgttttgataaaccctttctttgg
tatccttttaggttttataggaagtcaatgttttcgttctttgcagagctggtttccgta
actgaggggtatacagtaaccggtaaacaggtggcttcctatggaagggacgcttgggcc
ttgcaaaggaagattgacaaaatgctattgaagggagagcctgtgggtacgttgccagat
caagtcctggtgaatgcttcgagcaatttccctgcggcccaagtggttcccctggccaga
ctccttgacacctactatcagatgaggggcataaaatag

DBGET integrated database retrieval system