KEGG   Sphaerochaeta pleomorpha: SpiGrapes_2412Help
Entry
SpiGrapes_2412    CDS       T01673                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SpiGrapes_2412
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpiGrapes_2412
   00052 Galactose metabolism
    SpiGrapes_2412
   00500 Starch and sucrose metabolism
    SpiGrapes_2412
   00520 Amino sugar and nucleotide sugar metabolism
    SpiGrapes_2412
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SpiGrapes_2412
   00524 Butirosin and neomycin biosynthesis
    SpiGrapes_2412
Enzymes [BR:sgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SpiGrapes_2412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2641796..2642692)
Genome map
AA seq 298 aa AA seqDB search
MQYKLALDVGGTFIKSALVDTEGMIIESTLGESPTNSNGKPEEILDSFKSILERNRSLAS
FTEVGICIPGPFDYENGIFNMTQKFTSVRGMSLSPVFSAEGLEVKYLHDSTAFLLGEIAE
GAARGFDRPCGIMLGTGFGFTMSHGGRILINQEQRPCFSLWNKKFRDGIVEDTISRKAIR
ERYAKLSGDFSMPDVREIAALATGGDKNALAVFRDVGESIGEVISSYIPKKAYDFLVMGG
QISKAFDLMAPYIGLEIPVSRAANISDAAIRGVGRYLALGKDACTRVTTEKEALACWS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacaaactagcccttgatgtcggaggaactttcatcaaatccgcacttgttgat
acagaagggatgataattgagagcaccttgggggaaagcccgacaaatagtaacggcaaa
ccagaggagatcctcgattctttcaagtcaatacttgaaaggaaccgttcactggcatca
tttacggaagtgggaatctgtattcccggtccgttcgactacgagaacggaatcttcaat
atgacccagaaattcacctcggtcaggggaatgagccttagtcctgtcttcagcgcagaa
ggccttgaggtcaaatatctccatgattccaccgcgtttcttctcggagagatagcagaa
ggtgcagctaggggatttgacagaccctgtggaataatgctcggcactggtttcggtttt
accatgtcacacggcgggaggattctcatcaatcaggagcagagaccctgcttcagcctt
tggaacaagaaattcagagacgggatagttgaggatactatttcaagaaaggctatacgt
gaacgctatgcaaagctttcaggggatttttcaatgcccgatgtaagggaaatagcagct
ctggcgaccggaggggacaagaatgcccttgccgtattcagggatgtgggagaatccatc
ggagaggtaataagcagctacataccgaaaaaggcctacgacttccttgtaatgggtggt
cagatatccaaggcatttgacctgatggctccctacattgggctggagatcccagtatca
agggctgcaaatataagtgatgctgcaatccggggagttgggagataccttgcattaggc
aaggatgcatgcacaagggtaacaacagagaaagaggcccttgcatgttggagttga

DBGET integrated database retrieval system