KEGG   Sphaerochaeta pleomorpha: SpiGrapes_2412Help
Entry
SpiGrapes_2412    CDS       T01673                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
sgp00010  Glycolysis / Gluconeogenesis
sgp00052  Galactose metabolism
sgp00500  Starch and sucrose metabolism
sgp00520  Amino sugar and nucleotide sugar metabolism
sgp00521  Streptomycin biosynthesis
sgp00524  Neomycin, kanamycin and gentamicin biosynthesis
sgp01100  Metabolic pathways
sgp01110  Biosynthesis of secondary metabolites
sgp01120  Microbial metabolism in diverse environments
sgp01130  Biosynthesis of antibiotics
sgp01200  Carbon metabolism
Module
sgp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpiGrapes_2412
   00052 Galactose metabolism
    SpiGrapes_2412
   00500 Starch and sucrose metabolism
    SpiGrapes_2412
   00520 Amino sugar and nucleotide sugar metabolism
    SpiGrapes_2412
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SpiGrapes_2412
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SpiGrapes_2412
Enzymes [BR:sgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SpiGrapes_2412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: AEV30182
UniProt: G8QTE1
Position
complement(2641796..2642692)
Genome map
AA seq 298 aa AA seqDB search
MQYKLALDVGGTFIKSALVDTEGMIIESTLGESPTNSNGKPEEILDSFKSILERNRSLAS
FTEVGICIPGPFDYENGIFNMTQKFTSVRGMSLSPVFSAEGLEVKYLHDSTAFLLGEIAE
GAARGFDRPCGIMLGTGFGFTMSHGGRILINQEQRPCFSLWNKKFRDGIVEDTISRKAIR
ERYAKLSGDFSMPDVREIAALATGGDKNALAVFRDVGESIGEVISSYIPKKAYDFLVMGG
QISKAFDLMAPYIGLEIPVSRAANISDAAIRGVGRYLALGKDACTRVTTEKEALACWS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacaaactagcccttgatgtcggaggaactttcatcaaatccgcacttgttgat
acagaagggatgataattgagagcaccttgggggaaagcccgacaaatagtaacggcaaa
ccagaggagatcctcgattctttcaagtcaatacttgaaaggaaccgttcactggcatca
tttacggaagtgggaatctgtattcccggtccgttcgactacgagaacggaatcttcaat
atgacccagaaattcacctcggtcaggggaatgagccttagtcctgtcttcagcgcagaa
ggccttgaggtcaaatatctccatgattccaccgcgtttcttctcggagagatagcagaa
ggtgcagctaggggatttgacagaccctgtggaataatgctcggcactggtttcggtttt
accatgtcacacggcgggaggattctcatcaatcaggagcagagaccctgcttcagcctt
tggaacaagaaattcagagacgggatagttgaggatactatttcaagaaaggctatacgt
gaacgctatgcaaagctttcaggggatttttcaatgcccgatgtaagggaaatagcagct
ctggcgaccggaggggacaagaatgcccttgccgtattcagggatgtgggagaatccatc
ggagaggtaataagcagctacataccgaaaaaggcctacgacttccttgtaatgggtggt
cagatatccaaggcatttgacctgatggctccctacattgggctggagatcccagtatca
agggctgcaaatataagtgatgctgcaatccggggagttgggagataccttgcattaggc
aaggatgcatgcacaagggtaacaacagagaaagaggcccttgcatgttggagttga

DBGET integrated database retrieval system