KEGG   Sphaerochaeta pleomorpha: SpiGrapes_2500Help
Entry
SpiGrapes_2500    CDS       T01673                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SpiGrapes_2500
Enzymes [BR:sgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SpiGrapes_2500
Exosome [BR:sgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SpiGrapes_2500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2741965..2743485
Genome map
AA seq 506 aa AA seqDB search
MKYIGALDQGTTSTRFILFDTKGSIVASNQQEHQQIFPEPGWVEHDPWEIWDNASECITK
TLRKVEASGSDISCVGITNQRETIVAWNPKTGKVWHNAIVWQDLRGSELINKLKETVDLP
WLTEKSGLIFSPYFAASKIAWLLDNVSGLRPEAEKGNVVFGTIDTWLTWNLTGGKALVTD
VTNASRYMLMNIKTCQWDDELLALFRVPKCSLPTIVPSSGVVYANTSTNGPFRTEVPVCG
ILGDQQAALFGQACFTEGLGKSTYGTGCFLLVNTGTKLCTSKLGLLTTVAYQIGDAKPVY
ALEGSVAVAGSLVQWARDNLKIVSSPQELDKLATSVPDCGGVYIVPAFSGLFAPYWRSEA
RGVIAGLTGFATRAHLCRAILESTAFQANDIFESMEVDSGIHMTTLKVDGGLTNSEPLME
FQSDLLGIPVIRPLVVETTALGAAYAAGLSVGIWKDMDELASYWKEDRRWKPTMEKSVRD
KKIRLWRKAVSRTLNWISVDSEELES
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatattggagcgttggatcagggaactacaagtacccgttttatactttttgat
acaaaggggtcgattgtcgcatcaaaccagcaggaacaccagcagatattcccagaaccg
ggatgggtggaacatgatccgtgggaaatctgggacaatgccagcgaatgtatcaccaag
accttgagaaaagtagaagcatccggctctgatatttcctgtgtcggtatcacaaatcag
cgtgaaacgattgttgcctggaatccaaaaacggggaaagtctggcataatgcaatcgta
tggcaggatcttcggggatcagagctgatcaataagctgaaggaaacggttgacttgcct
tggcttacggaaaaaagcggtttgattttcagcccctactttgcagcctccaagattgcc
tggttgcttgataatgtgtctggtttgcgcccggaagcggagaaagggaatgttgtcttc
ggtaccatcgatacctggttgacctggaatctgacaggggggaaagcccttgtcaccgat
gtgacaaacgcctcacggtacatgcttatgaatatcaagacctgccaatgggatgatgaa
ttgctagccttgttcagggtgccaaaatgttcattgcctaccatcgttccctcttctggc
gtagtctatgccaatacctctacaaatggacctttccgtactgaagtccctgtctgcgga
attcttggggaccagcaggctgccttgtttggtcaggcttgttttaccgaaggcctgggc
aagagcacctatggaaccggttgctttttattggtgaacacagggactaaactctgcact
tccaaattagggcttctcaccacggtagcctaccagataggggatgctaaacctgtctat
gccctggaagggtctgtggctgtcgccgggtcgctggtccagtgggcccgggataaccta
aaaattgtaagttccccacaggaactggacaaactggccacctctgtgccagactgcgga
ggtgtctatatcgttccggcgttcagcggattgtttgcaccctactggaggtctgaagcc
cgtggggtaatcgcaggtcttaccggttttgcaacgagggctcatctatgccgggcaata
ttggagtccaccgcgtttcaggcaaacgatatatttgagtctatggaggttgatagcgga
atccatatgaccaccttgaaagttgacggtggtctcaccaacagtgagccacttatggaa
ttccagtcagatttgcttggtatcccggtaatccggcccttggttgtagagactactgcc
ttaggtgcggcctacgctgcagggctgtctgtaggtatctggaaagatatggatgagttg
gcttcctattggaaagaagataggcgctggaaaccaaccatggagaaaagtgtcagggat
aagaaaatacgattatggagaaaagccgtaagccgtaccctcaattggatttctgtcgat
agcgaagaactggagtcatag

DBGET integrated database retrieval system