KEGG   Sphaerochaeta pleomorpha: SpiGrapes_2577Help
Entry
SpiGrapes_2577    CDS       T01673                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SpiGrapes_2577
Enzymes [BR:sgp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     SpiGrapes_2577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2827336..2829162)
Genome map
AA seq 608 aa AA seqDB search
MANVSDIKSIGPEIRYAGSFPKIGIRPVIDGRQRGVRESLEVQTMNMAKSAAKLISDNVR
YSNGNKVECVLADTTIGGVRESADCAAKFEKEGVAITLTVTPCWCYGTETFDMNPMTVKA
VWGFNGTERPGAVYLAAVLAAHTQKGLPAFGIYGRDVQDNSDTTIPEDVSEKILRFARAA
LAVATMRDKSYLSIGGCAMGIAGSIVDQDLLQSYLGMRTEAIDMCEIERRIVEEIYDHEE
FKKAIKWVKENCIQPKDTVNEEKYRRSEEQLEKDWEYCTKMTMIGRDLMIGNKELKKIGF
GEESLGHNALFAGFQGQRQWTDHWPNGDFMETMLCTSFDWNGIREPFVMATENDFLNGIG
MLFGKLLTNRATIFSDVRTYWSPSAIERVTGWKPTGLAKDGFIHLINSGATTLDAAGKMK
NAKGESEMKHFWEITSEDVANTLDNSRFSAANCGYFRGGGFSSTFLSEGGMPVTMVRMNT
VKGLGPVLQIAEGWTCEVPENVFDTINKRTDQTWPTTWFVPRIDGKDGPFKDVYSVMANW
GANHGAISYGHIGADMITLCSMLRIPVCMHNVPDADIFRPSAWTMMGMEKESADFRACET
FGPLYGKY
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgtttctgatattaaatccatcggaccagaaattcgatatgcaggctccttt
cctaaaatcggaataagaccggtaatcgatggaagacaacggggagttcgggaatcactc
gaagtccagaccatgaatatggcaaagtcagcagcaaaactcatcagtgacaatgttcgc
tattccaatggcaacaaagtcgagtgcgtactcgccgacaccaccattggcggggtcagg
gaaagtgccgactgtgctgcaaaattcgaaaaggaaggggttgccattacccttaccgtt
acaccctgctggtgctacggaacagaaacctttgacatgaatccgatgaccgtcaaggct
gtctggggttttaatggcactgaacgaccgggtgctgtctatctggctgccgtattggct
gcccatacccagaaggggctccctgcctttgggatctatggccgcgatgtccaagacaac
agcgacacaacgattcctgaagatgtatctgagaaaatccttcgctttgcacgtgcggct
ctggcagttgccacaatgagagataaaagttacttgtccattggcggctgtgccatgggt
attgctggctccatcgtcgaccaggacctgttgcagtcttacctgggaatgagaactgaa
gccattgacatgtgtgagatcgaacgcaggatagtcgaggaaatctacgaccacgaagag
ttcaaaaaggctatcaaatgggtcaaggaaaactgtatccaacccaaagatactgtcaac
gaagagaaataccggcgcagtgaagaacagttggagaaagactgggaatactgcacaaag
atgaccatgatcggccgtgacctgatgatcgggaataaagaactcaagaaaatcggtttc
ggtgaggagagccttggccacaatgccctgtttgcaggattccaaggccaaaggcaatgg
acagaccattggccaaatggcgatttcatggaaaccatgctgtgtacctcatttgactgg
aatggaatcagagagcctttcgtcatggctaccgagaatgactttctcaatggtatcgga
atgcttttcggcaaactccttaccaacagggcaaccatcttcagcgatgttcgcacctat
tggagtcccagtgccatcgaacgggtcactggctggaaaccgaccggacttgcaaaggat
ggattcatccatcttatcaacagcggggctacaaccctcgatgcagcgggaaaaatgaag
aatgccaaaggcgaaagcgaaatgaagcatttctgggaaattaccagcgaagatgttgca
aacaccttggacaactcccgcttcagcgcagcaaactgtggatacttccgtggcggcggg
ttcagttccaccttcctcagtgaagggggaatgccggtgaccatggtccgcatgaatacg
gtaaagggcttgggtcctgtattgcagatagctgaaggctggacctgcgaagttcccgag
aacgtattcgacaccatcaacaagagaaccgaccagacctggccgactacttggttcgtc
ccccgcatcgacgggaaagacggtccgttcaaggatgtctattctgtcatggcaaactgg
ggagccaaccacggggcgatcagttatgggcatatcggtgccgatatgattaccctctgc
tcgatgcttcgcattcctgtatgcatgcacaatgtcccggatgcagatatcttccgcccg
agtgcctggacgatgatgggcatggagaaggaaagcgccgatttccgggcttgcgagact
tttggccctctatacggtaaatattaa

DBGET integrated database retrieval system