KEGG   Sphaerochaeta pleomorpha: SpiGrapes_2928Help
Entry
SpiGrapes_2928    CDS       T01673                                 

Definition
arginase family hydrolase, arginase/agmainase/formiminoglutamate hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SpiGrapes_2928
Enzymes [BR:sgp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SpiGrapes_2928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3192280..3193170
Genome map
AA seq 296 aa AA seqDB search
MQPYFLDSEYPNTRVEDALFHVIQVPLEATVSYMGGTANGPKAIVEASGQLETLVEGMGE
PGTFGIHTYDAVSCSYEKSPEEVFARASVLMEKAFGQNSFPLLLGGEHSVTNAAVMALTA
TYEKGSVGILQFDAHMDLRSSYEGSVFSHASVMYRAVEAGIPLFQVGIRNYSSEDLAARN
EYKVGFYDASELYRLAHSPAGLASLTLPDSFPEKLYITFDVDGFDASLMSATGTPDPGGL
FWWDAITLLDVLTKGRTIVGSDVVELAPNKMLYHCDYTAAKLAYYLMGLMETRRKQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccctattttttagattctgagtatcccaatacccgagttgaagatgcactgttt
catgtaatccaggttccccttgaagcaactgtctcctatatgggagggactgcaaatgga
ccaaaggcaattgtagaggcttccggtcaactggagacactggttgagggaatgggcgaa
ccaggtacgtttgggattcacacctatgatgcagtttcctgttcgtatgaaaagagccct
gaagaggtgtttgcccgagcttctgtcctgatggaaaaagcctttggccagaactctttt
cccttgctactaggaggtgagcacagtgttaccaacgcagctgtaatggccttgactgca
acgtatgagaaggggagtgtcgggatcttgcagttcgatgctcatatggatcttcgctct
tcctatgaaggttccgtcttcagtcatgcatctgtcatgtaccgtgcagtggaagcaggg
attcctttgttccaggtcgggataagaaattacagcagtgaagaccttgcggctagaaac
gagtataaggtgggtttttatgatgcctcggaactctacaggctagcacattctccagcg
ggtctcgcctcgcttacgcttcctgattccttccctgagaaactctatataacgtttgat
gtcgatggttttgatgcttctttgatgagtgctacaggaacgcctgatccgggtggcctt
ttttggtgggatgccattaccttgttggatgtccttactaagggaaggaccatcgtagga
tctgatgtggtggagcttgcccccaataagatgctctatcattgtgactacactgcagca
aaactagcctattatcttatgggtctcatggagacaagaagaaagcaataa

DBGET integrated database retrieval system