KEGG   Sphaerochaeta pleomorpha: SpiGrapes_3015Help
Entry
SpiGrapes_3015    CDS       T01673                                 

Definition
uracil DNA glycosylase superfamily protein
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    SpiGrapes_3015
Enzymes [BR:sgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     SpiGrapes_3015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3285239..3285973
Genome map
AA seq 244 aa AA seqDB search
MEFAHTVRDRTLLLRSQVESLRFSKDYIVYDPLDYAWNLHEQYILRYLCHPVKAIFLGMN
PGPFGMAQTGVPFGEINAVKTFMKIEGEVGKPSFEHPARPVKGLSIQRSEVSGKRLWGLL
SDHYATAEQCFGEVSVLNYCPLVFMDRGPTGKNITPDKLPKIERLALETICDSYLSDLVV
LLEPTYLIGVGNYAKAKLMKIAESLGTGCKVDSILHPSPGNPLANKGWAEKTEQKLIDLG
VWDA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgcccatacggttcgtgatcgtacgttgttgctcaggtctcaggtggaatcg
ttgcgattctccaaagattacattgtctatgaccccctcgattatgcctggaacctgcat
gaacagtatattttacgatatctttgccacccagtgaaagctatcttccttggaatgaac
cctggtcccttcggcatggcacagacaggggtgccctttggcgaaatcaatgcagtgaaa
acgttcatgaaaattgaaggggaggttggaaaaccttcttttgaacatcctgcacggccg
gtgaaaggtctttccatccaacggagcgaagttagcggaaagcggctctgggggttgctg
tcagatcattatgctactgctgaacaatgttttggggaggtttccgtattgaactattgt
ccccttgtcttcatggataggggtcccacaggaaaaaacattacccctgacaaacttccc
aagattgaacgtcttgctttggaaaccatatgtgatagctatttgtcggatttggttgtc
ctgctggagcctacctatttgataggggtcggcaactatgcaaaagcaaaactgatgaaa
atcgcagaatcacttggcacaggttgcaaggtcgattccattctgcatccaagcccggga
aatcctcttgccaacaaggggtgggctgagaaaaccgaacagaaattgatagatcttggg
gtatgggacgcgtag

DBGET integrated database retrieval system