KEGG   Sphaerochaeta pleomorpha Grapes: SpiGrapes_3134Help
Entry
SpiGrapes_3134    CDS       T01673                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
sgp  Sphaerochaeta pleomorpha Grapes
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:sgp01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sgp01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sgp00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3408751..3409791)
Genome map
AA seq 346 aa AA seqDB search
MEKKIRVGVAGYGVIGQRLADGVALQGDMELVGVADVMPTLSVRALKEKGMPYRLFAASV
EGKAALEGAGIPISGMLEDLVQQVDIMLDATSAGIGAKNKLLYEKYGKHAIFQGGEKNDV
ANVFFHGYANFEKGLGVDFLKLTSCNTTGLIRAVDCIDRAVGVEKVAITIIRRVADPGDY
HRGLTNALQIDKAPSHQALDLMTIMPHVEATGILIHTPVTHGHIITVVLTPKQDISVKDA
LEIFEKHPRIRVVSIGEGFLGNASLFRYARDLGNPRGDMYEIAVWSDSVVKSGRDLMFAI
NIPQESVVIPENIDAIRSSMKMQLTRETGTAETNKYLRIGTWKKTV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaaatacgggtaggtgtcgccggatatggcgttatagggcaacggctggca
gatggggttgccttgcagggtgacatggaactggttggggttgcagatgttatgcccacc
ctcagcgtgagggccctgaaagaaaaagggatgccctacagattgtttgccgcatcggtt
gagggcaaggcagctcttgaaggggcaggcattcctatcagtggtatgctcgaagacttg
gtccagcaggttgatatcatgctcgatgccaccagtgcgggcatcggtgcgaaaaacaag
ctcctgtatgagaaatatggcaagcatgccattttccagggcggggaaaaaaacgatgtc
gcaaatgtcttcttccatggctatgcgaactttgagaaagggctcggcgtcgatttcctc
aaactgacctcctgcaatacgaccggcctcatccgtgccgtagactgcatcgacagggcc
gtcggggtggaaaaggtggccatcaccatcataaggcgtgtcgccgaccccggggactac
caccgcgggctgacgaacgcgctgcaaatcgacaaggcaccaagccaccaggcactggac
ctgatgaccatcatgccccatgtcgaggcaacgggtatcctgatccataccccggtcacc
catgggcatatcatcacggtggtactcaccccgaaacaggatatcagcgtcaaggatgcc
ctcgagatcttcgagaagcacccacgtatcagggtggtttcgataggcgagggattttta
gggaatgcgagcctgttcaggtatgcccgtgaccttggcaacccccgcggtgacatgtat
gagattgccgtatggagcgactccgtggtaaagagcggcagggacctgatgttcgccatc
aatatcccccaggagtctgtggtcatcccggaaaacattgacgcgatccggtcttccatg
aagatgcagctcacccgtgagacagggacggctgagacaaacaaatacctcaggatagga
acatggaaaaaaaccgtataa

DBGET integrated database retrieval system