KEGG   Sphaerochaeta pleomorpha Grapes: SpiGrapes_3246Help
Entry
SpiGrapes_3246    CDS       T01673                                 

Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sgp  Sphaerochaeta pleomorpha Grapes
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sgp00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sgp00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3546530..3548011)
Genome map
AA seq 493 aa AA seqDB search
MQKKQPKKASELLMPLPLHIVDLEGAFRLHNGTTISFAPEFKEIAELAQQQLQCNLGGED
VFLKKTDTLPREGYTLKVTKNQVVIAASQSEGAFHGFMTLRQMALANDNIIPCCKIEDEP
LYSWRGFMLDCSRHFFSPAFIKKLIDAAALHHLNRFHWHLTDDQGWRFPIDGYPNLETIG
SKRAELQYSGQTTYGGFYQEEEIKEIVAYAKQRQVVVIPEIETPGHASALLASYPHLGCT
EGPYAVQDRWGIFEDVLCAGNDEVLEFLKAAIATLARLFPGPYIHIGGDECPHAQWERCP
KCQSRMQKNNLHSEKELQAWMTTQVAKIVEDEGKQPIGWDEVLEGSETLGLPESLIVMSW
RGTEGGRKASELGHQIIMSPNTAGCYFDYKHLDSIEEPGNLGVTTLQDTALFNPCPVDLD
EASQKMVLGGQGNLWTEKIVYSKHAEYMLFPRLSILAERLWNPQEMSSILSRRNSLEKKL
SALDFDCFKGNSN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaaaacaaccaaagaaggcatcggaactccttatgcctcttcctttgcatatc
gtagacctagaaggggcctttcgtctccacaacggcactaccatcagctttgcaccggaa
ttcaaagaaatcgctgaacttgcgcagcaacagttacagtgcaacttagggggagaagat
gtctttttgaaaaagacagacacgctaccgagggaggggtacacccttaaagtaaccaaa
aaccaggttgttatcgcagcttcccagtctgaaggggcgtttcacggtttcatgaccctt
aggcagatggcactggccaatgacaacatcatcccctgttgcaaaatcgaggacgaacca
ttatacagctggcgtggtttcatgctcgactgcagcaggcatttcttttcacctgcattc
atcaagaaactcatcgatgcggcggcactgcaccacctgaaccgtttccattggcatctt
accgatgaccagggctggcgtttccctatagatggctatccaaaccttgagacgataggg
tctaagcgggcagaactccaatattcgggacagactacctatggcgggttttaccaggaa
gaagagatcaaagaaatagtagcctatgccaaacagcgccaagtggtggtaatccctgaa
atcgaaaccccaggccacgcctctgccttgcttgcttcctatccccatctcggctgcacc
gaagggccctatgcagtgcaggaccgctggggtattttcgaagatgtactgtgtgcggga
aatgacgaggtcttggaattcctcaaggctgccatcgctacgctggccaggcttttcccc
ggtccttatatccatatcggtggggatgaatgtccccatgcccaatgggagcgatgcccg
aaatgccaaagtaggatgcaaaaaaacaatctgcactccgaaaaggaactccaagcctgg
atgacaacccaagtcgcaaaaatagtagaggatgagggcaagcagcccataggatgggat
gaggttcttgaagggagcgaaacacttggtttaccagaaagccttattgttatgtcctgg
agaggaacagagggaggccgcaaggcaagcgagctcggccaccagataataatgagcccc
aacacagcagggtgttacttcgattacaagcacctcgacagtattgaggaaccgggcaat
ctgggagtaaccacgcttcaggacacggcccttttcaatccctgccctgttgatctggac
gaggccagtcagaaaatggtgcttggtggacaaggaaacctttggaccgaaaaaatcgta
tattccaaacatgcggaatatatgcttttcccacggttatcgatcctggcggaaagactt
tggaatccccaggaaatgtcgagtatactttcgaggagaaacagccttgaaaagaagctt
tcggcattggattttgattgcttcaagggaaatagcaattaa

DBGET integrated database retrieval system