KEGG   Streptomyces griseus: SGR_1149Help
Entry
SGR_1149          CDS       T00691                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sgr  Streptomyces griseus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sgr01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sgr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(1356339..1357256)
Genome map
AA seq 305 aa AA seqDB search
MGRMRTIVVLDAPSNLGLRPPAPGTVPGCYKLAGALREQRIVRRLGALEGGVVVPPRYDL
GDWREGDGVFNAAAIARYTRTLADRIEGHVRAGEFALVLGGDCSIQLGAALALRRIGRYG
LAAVDGSADFRHPGNSDRIGAAGGEELAIATGRGQADLSDIEGLGPYLRDEDVRLFGMRD
EDEDRAELAALKIPHATVGQIRAGGPDTLGRAAVESLETPALDGYWVHLDADVLDPAVMP
AVDSPDDGGLLPHELAPLLRALVSSPRCVGLNVTIYDPDLDPDGTAGALLADLVVDAFTG
TAPEA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtatgcgtacgatcgtggtcctcgacgccccttccaacctcgggctgcgcccg
ccggcccccggcaccgtcccgggctgctacaaactggccggcgccctgcgcgaacagcgg
atcgtgcgccgcctcggagcgctggagggcggcgtcgtcgtcccgccgcgctacgacctg
ggcgactggcgggagggcgacggggtgttcaacgccgccgccatcgcccggtacacccgc
accctcgccgaccgcatcgaaggccacgtacgggccggggagttcgccctggtcctcggc
ggggactgctccatccagctcggcgccgccctggccctgcgccggatcggccgctacgga
ctcgccgccgtcgacgggtcggcggacttccggcaccccggcaacagcgaccggatcggc
gcggccggcggcgaggaactggccatcgccaccggccggggccaggccgacctcagcgac
atcgaagggctcggcccctacctcagggacgaggacgtccgcctcttcggcatgcgggac
gaggacgaggaccgggccgagctcgccgcgctgaagatcccccacgccaccgtcgggcag
atccgcgcggggggcccggacaccctcgggcgggccgcggtggagagcctggagaccccc
gcgctcgacggctactgggtccacctggacgccgacgtcctcgacccggccgtcatgccg
gccgtcgacagccccgacgacggcggcctcctcccgcacgaactcgccccgctgctgcgc
gcgctcgtctcctccccgcgctgcgtcgggctgaacgtcaccatctacgaccccgatctc
gacccggacggcacggcgggcgccctgctcgccgacctcgtcgtcgacgcgttcacgggc
accgccccggaggcctga

DBGET integrated database retrieval system