KEGG   Streptomyces griseus: SGR_1195Help
Entry
SGR_1195          CDS       T00691                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sgr  Streptomyces griseus
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sgr00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:sgr00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
1410082..1410825
Genome map
AA seq 247 aa AA seqDB search
MDLTGRTALVTGGGSGIGRATAEALAGAGALVHVVDREAGSATSVAAAIGGVAHVVDLAE
PEAVATLPTGVDVLVNNAGLQHVAAIEDFPPDRFELIQKVMVTAPFLLMRHCLPHMYAGG
WGRIVNVSSMHGLRASAFKSAYVAAKHGLEGLSKVAALEGAPHGVTSNCVNPGYVRTPLV
EGQIAGQAAAHGIPPEEVVTGILLDRSAIKRLIEPEEVAAVCRWLCGPHTGYITGVSLPV
DGGWGAH
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtggacctcacggggcgcaccgccctggtcaccggcggcggcagcggcatcgggcgggcc
accgccgaggcgctcgccggggccggcgccctcgttcacgtggtcgaccgcgaggccggg
agcgccacgtccgtcgccgccgcgatcggcggcgtggcgcacgtcgtggacctggccgaa
cccgaggcggtcgcgacactgccgaccggggtggacgtgctggtcaacaacgccgggctc
cagcacgtggccgccatcgaggactttccgccggaccgcttcgagctgatccagaaggtg
atggtgaccgccccgttcctgctgatgcggcactgcctcccgcacatgtacgccgggggg
tggggccggatcgtcaacgtctccagcatgcacgggctgcgggccagcgccttcaagtcc
gcctacgtcgcggccaagcacggcctggaggggctgagcaaggtggccgccctggagggc
gccccgcacggggtgaccagcaactgcgtcaaccccggctatgtgcgcacaccgctggtg
gagggccagatcgcgggccaggccgccgcgcacgggatccccccggaggaggtcgtcacc
ggcatcctcctggaccggtccgcgatcaagcggctgatcgaacccgaggaggtcgccgcc
gtctgccgctggctctgcggcccccacaccggctacatcaccggcgtctcgctccccgtc
gacgggggctggggcgcccactga

DBGET integrated database retrieval system