KEGG   Streptomyces griseus: SGR_1195Help
Entry
SGR_1195          CDS       T00691                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sgr  Streptomyces griseus
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SGR_1195
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SGR_1195
Enzymes [BR:sgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     SGR_1195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
1410082..1410825
Genome map
AA seq 247 aa AA seqDB search
MDLTGRTALVTGGGSGIGRATAEALAGAGALVHVVDREAGSATSVAAAIGGVAHVVDLAE
PEAVATLPTGVDVLVNNAGLQHVAAIEDFPPDRFELIQKVMVTAPFLLMRHCLPHMYAGG
WGRIVNVSSMHGLRASAFKSAYVAAKHGLEGLSKVAALEGAPHGVTSNCVNPGYVRTPLV
EGQIAGQAAAHGIPPEEVVTGILLDRSAIKRLIEPEEVAAVCRWLCGPHTGYITGVSLPV
DGGWGAH
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtggacctcacggggcgcaccgccctggtcaccggcggcggcagcggcatcgggcgggcc
accgccgaggcgctcgccggggccggcgccctcgttcacgtggtcgaccgcgaggccggg
agcgccacgtccgtcgccgccgcgatcggcggcgtggcgcacgtcgtggacctggccgaa
cccgaggcggtcgcgacactgccgaccggggtggacgtgctggtcaacaacgccgggctc
cagcacgtggccgccatcgaggactttccgccggaccgcttcgagctgatccagaaggtg
atggtgaccgccccgttcctgctgatgcggcactgcctcccgcacatgtacgccgggggg
tggggccggatcgtcaacgtctccagcatgcacgggctgcgggccagcgccttcaagtcc
gcctacgtcgcggccaagcacggcctggaggggctgagcaaggtggccgccctggagggc
gccccgcacggggtgaccagcaactgcgtcaaccccggctatgtgcgcacaccgctggtg
gagggccagatcgcgggccaggccgccgcgcacgggatccccccggaggaggtcgtcacc
ggcatcctcctggaccggtccgcgatcaagcggctgatcgaacccgaggaggtcgccgcc
gtctgccgctggctctgcggcccccacaccggctacatcaccggcgtctcgctccccgtc
gacgggggctggggcgcccactga

DBGET integrated database retrieval system