KEGG   Streptomyces griseus: SGR_1272Help
Entry
SGR_1272          CDS       T00691                                 

Definition
(GenBank) putative sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sgr  Streptomyces griseus
Pathway
sgr00010  Glycolysis / Gluconeogenesis
sgr00052  Galactose metabolism
sgr00500  Starch and sucrose metabolism
sgr00520  Amino sugar and nucleotide sugar metabolism
sgr00521  Streptomycin biosynthesis
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01130  Biosynthesis of antibiotics
sgr01200  Carbon metabolism
Module
sgr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGR_1272
   00052 Galactose metabolism
    SGR_1272
   00500 Starch and sucrose metabolism
    SGR_1272
   00520 Amino sugar and nucleotide sugar metabolism
    SGR_1272
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SGR_1272
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SGR_1272
Enzymes [BR:sgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SGR_1272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase FGGY_N BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: BAG18101
Kitasato: SGR1272
UniProt: B1VVB7
Position
complement(1495562..1496728)
Genome map
AA seq 388 aa AA seqDB search
MSTYRDFAHRGSARATVLKTVGTKERRSHLTAPRVPTVGIDIGGTKVMAGVVDADGNILE
QLRTETPDKSKSPKVVEDTIVELVLDLSDRHDVHAVGIGAAGWVDADRSKVLFAPHLAWR
DEPLRDAIASRLVVPVMVDNDANTAAWAEWRFGAGRGEDHLVMITLGTGIGGAILEDGQV
KRGKYGVAGEFGHMQVVPSGHRCPCGNRGCWEQYSSGNALVREARELAAADSPVAHYLLD
RVKGNVADITGPLITELAREGDAMCIELLQDIGQWLGIGIANLAAALDPSCFVIGGGVSA
ADDLLINPARDAFKRHLTGRGYRPEARIAKAQLGPEAGMVGAADLARLVARRFRRANRRR
VERYERYAQIYDQAASTIRNTRSTRTAD
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgtaccgcgacttcgcacaccgcggctcagcccgcgccaccgtcctcaagacc
gtcggcaccaaggaacgccgctcgcacctcaccgccccgcgggttcccacggtcgggatc
gacatcggcggcaccaaggtgatggcgggagtcgtcgacgcggacggcaacatcctggaa
cagctccgcaccgagacgcccgacaagtccaagagccccaaggtcgtcgaggacaccatc
gtcgagctggtcctggacctctccgaccgccacgacgtccacgcggtgggcatcggcgcg
gcgggctgggtggacgccgaccgctccaaggtcctgttcgccccgcacctcgcctggcgc
gacgagcccctgcgcgacgccatcgcctcccgcctcgtcgtccccgtcatggtcgacaac
gacgccaacaccgccgcctgggcggaatggcgcttcggggcgggccggggcgaggaccac
ctcgtcatgatcaccctcggtacgggcatcggcggcgcgatcctggaggacggccaggtc
aagcgcggcaagtacggcgtggccggtgagttcggccacatgcaggtcgtgccctcgggc
caccgctgcccctgtggcaaccggggctgctgggagcagtacagctccggcaacgccctg
gtccgcgaggccagggaactcgccgcggccgactcgccggtcgcccactacctgctggac
cgggtgaaggggaacgtcgccgacatcaccgggcccctcatcaccgaactggcccgcgag
ggcgacgcgatgtgcatcgagttgctccaggacatcggccagtggctcggcatcggcatc
gccaatctggccgccgcgctcgacccctcctgcttcgtcatcggaggcggcgtcagcgcc
gccgacgacctgctgatcaaccccgccagggacgccttcaagcgccacctcaccggacgc
ggctaccgccccgaggcccggatcgcgaaggcgcagctcggccccgaggcgggtatggtc
ggcgccgcggacctggcccggctggtcgcccgccgattccgccgggccaaccggcggcgc
gtcgagcggtacgagcggtacgcccagatctacgaccaggcggcgagcaccatccgcaac
acgcggtccacccgaaccgctgactga

DBGET integrated database retrieval system