KEGG   Streptomyces griseus: SGR_1297Help
Entry
SGR_1297          CDS       T00691                                 

Gene name
aceB
Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sgr  Streptomyces griseus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGR_1297 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SGR_1297 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    SGR_1297 (aceB)
Enzymes [BR:sgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SGR_1297 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
1520133..1521752
Genome map
AA seq 539 aa AA seqDB search
MSAPAPSTLAIVDAEPLPRQEEVLTDAALAFVAELHRQFTPRRNELLARRGERRAEIART
STLDFLPETAAVRADTSWKVAPAPAALNDRRVEITGPTDRKMTINALNSGAKVWLADFED
ASAPTWENVVLGQLNLTDAYERRIDFTDPKSGKSYALKSADELATVVMRPRGWHLEERHL
QLDGVSVPGALVDFGLYFFHNAQRLIDLGKGPYFYLPKTESHLEARLWNDVFVFAQDYVG
IPQGTVRATVLIETITAAYEMEEILYELRDHAAGLNAGRWDYLFSIVKNFRDGGSKFVLP
DRNAVTMTAPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRRDAEVNKVAFEKVKADKDR
EANDGFDGSWVAHPDLVPIALASFDAVLGEKPNQKDRLREDVSVAPGDLIAIDTLDASPT
YDGLRNAVAVGIRYIEAWLRGLGAVAIFNLMEDAATAEISRSQIWQWINAGVVFENGEHA
TADLARKVAAEELAAIREEIGEETFTAGKWQQAHDLLLQVSLDQDYADFLTLPAYEQLR
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaccagcgccgtccacgctggccatcgtcgatgccgagcccctgccccggcag
gaagaggtcctgaccgacgcggccctcgcgttcgtggccgaactgcaccggcagttcact
ccgcgccgcaatgagctgctcgcccggcgcggtgagcgccgcgccgagatcgcccgcacc
tccacgctggacttcctgcccgagacggcggcggtccgcgcggacacctcctggaaggtc
gcgcccgccccggcggcgctgaacgaccgccgggtggagatcaccggtccgaccgaccgc
aagatgaccatcaacgccctgaactcgggcgcgaaggtctggctcgccgacttcgaggac
gcgtccgcccccacctgggagaacgtcgtcctcggccagctcaacctgaccgacgcctac
gagcgccgcatcgacttcaccgacccgaagtccggcaagtcgtacgcgctgaagtccgcc
gacgaactcgccaccgtcgtcatgcgcccgcgcggctggcacctggaggagcgccacctc
cagctggacggcgtctccgtgcccggcgcgctcgtcgacttcggcctctacttcttccac
aacgcccagcgcctgatcgacctcggcaagggcccgtacttctacctgccgaagacggag
tcgcacctggaggcccgcctctggaacgacgtgttcgtcttcgcccaggactacgtcggc
atcccgcagggcacggtccgcgcgaccgtcctgatcgagacgatcaccgccgcgtacgag
atggaggagatcctctacgagctgcgcgaccacgcggccgggctgaacgcgggccgctgg
gactacctcttctccatcgtcaagaacttccgtgacggcgggtcgaagttcgtcctgccg
gaccgcaacgcggtgacgatgaccgccccgttcatgcgggcgtacaccgaactcctggtc
cgcacctgccacaagcgcggcgcgcacgcgatcggcggcatggcggccttcatcccctcg
cgccgcgacgccgaggtcaacaaggtggccttcgagaaggtcaaggccgacaaggaccgc
gaggccaacgacggcttcgacggttcctgggtcgcccaccccgacctggtcccgatcgcc
ctggcctccttcgacgcggtcctcggcgagaagcccaaccagaaggaccgcctccgcgag
gacgtctcggtggcgccgggcgacctcatcgccatcgacaccctcgacgcgagcccgacc
tacgacggcctgcgcaacgccgtcgcggtcggcatccgctacatcgaggcctggctgcgc
ggcctgggcgcggtcgccatcttcaacctgatggaggacgccgccaccgcggagatctcc
cgctcgcagatctggcagtggatcaacgcgggcgtggtcttcgagaacggcgagcacgcc
acggccgacctggcccgcaaggtcgccgccgaggagctggccgcgatccgcgaggagatc
ggcgaggagaccttcaccgccggcaagtggcagcaggcccacgacctcctgctccaggtc
tccctggaccaggactacgcggacttcctgacgctgccggcgtacgagcagctgcgctga

DBGET integrated database retrieval system