KEGG   Streptomyces griseus: SGR_1470Help
Entry
SGR_1470          CDS       T00691                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sgr  Streptomyces griseus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SGR_1470
Enzymes [BR:sgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SGR_1470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(1714769..1716244)
Genome map
AA seq 491 aa AA seqDB search
MQRSQQCAETPPGHVVVIGGGIAGLAAAHHLVAAGLRVTLLEATDRVGGKLMTGEIAGVQ
VDLGAESMLARRPEAVALAEAVGLGDRLQPPATATASLWTRDALRPMPKGHVMGVPGDPA
VLGEVLSPEGLARIAEERDLTPTPVGDDVAVGAYVADRLGREVVDRLVEPLLGGVYAGDA
YRISMRAAVPQLFEAVKEGGPLLEGVRRIQERAAARQLTGPVFQGLAGGIGTLPAAVADA
VRAGGGEIRTETPVLGLTRTESGWAVRTDARTIAADGIVLATPAWSAGTLLAAESPAASA
ELSGVEYASMALVTLAFRRADIEHHEALRGRSGFLVPPVDGHTIKASTFSSNKWQWVADA
APDLFVLRTSVGRYGEEDHLHREDEELVAVSLRDLAAATGLTARPVDTEVTRWIGGLPQY
PVGHLARVARIRDEVAKLPALRVCGAVYDGVGIPACVASAHRAADEIAREITGEIITTST
LVRGTGSEAGQ
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgttctcaacagtgtgcggaaacgcccccgggccacgtcgtcgtcatcggcggc
ggcatcgccggcctggcggccgcccaccacctggtcgccgccggactgcgggtcaccctc
ctggaggcgacggaccgggtcggcgggaagctcatgaccggcgagatcgcgggcgtccag
gtcgacctgggggccgagtcgatgctcgcccggcgccccgaggcggtcgccctggccgag
gcggtgggcctcggcgaccggctccagccgcccgccaccgccacggcctcgctctggacg
cgcgacgcgctgcgcccgatgcccaagggccacgtcatgggcgtccccggcgatcctgcg
gtcctcggcgaggtgctgtcccccgaggggctggcccggatcgccgaggagcgtgacctc
acccccacccccgtcggcgacgacgtcgcggtcggcgcgtacgtcgccgaccggctcggc
cgcgaggtcgtggaccggctggtggagcccctcctcggcggggtctacgccggtgacgcc
taccggatctcgatgcgcgccgccgtcccccagctgttcgaggcggtgaaggagggcggg
ccgctgctggagggcgtccgccgcatccaggagcgggccgccgcgaggcagctgaccggc
cccgtcttccagggcctcgcgggcggcatcggcaccctcccggccgccgtcgccgacgcc
gtacgggccggcggcggcgagatccgcaccgagacccccgtcctcgggctgacccgtacg
gagtcgggctgggccgttcgcaccgacgcccggacgatcgccgccgacggcatcgtcctg
gccacccccgcctggtccgcgggcaccctgctggcggccgagtccccggccgcctccgcc
gagctgtccggcgtcgagtacgcctcgatggccctggtcaccctggccttccggcgggcc
gacatcgagcaccacgaggccctgcgcggccgctccggcttcctcgtgccgccggtcgac
gggcacacgatcaaggcgtccacgttctccagcaacaagtggcagtgggtcgcggacgcc
gcccccgacctcttcgtgctccgtacctccgtcggccgctacggcgaggaggaccacctg
caccgcgaggacgaggagctcgtcgccgtctccctgcgcgacctcgccgccgccaccggc
ctcaccgcccggcccgtcgacaccgaggtcacccgctggatcggcggcctgccgcagtac
ccggtgggccacctcgcccgcgtcgcccgcatccgcgacgaggtcgccaagctccccgcc
ctgcgggtctgcggcgcggtctacgacggcgtcgggatccccgcctgcgtcgcgagcgcg
caccgggcggccgacgagatcgcgcgggagatcacgggagagatcatcaccacgtcgacc
ctggtgcggggcaccgggagcgaggcgggacaatag

DBGET integrated database retrieval system