KEGG   Streptomyces griseus: SGR_1644Help
Entry
SGR_1644          CDS       T00691                                 

Gene name
aceB2
Definition
(GenBank) putative malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sgr  Streptomyces griseus
Pathway
sgr00620  Pyruvate metabolism
sgr00630  Glyoxylate and dicarboxylate metabolism
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01200  Carbon metabolism
Module
sgr_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SGR_1644 (aceB2)
   00630 Glyoxylate and dicarboxylate metabolism
    SGR_1644 (aceB2)
Enzymes [BR:sgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SGR_1644 (aceB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: BAG18473
Kitasato: SGR1644
UniProt: B1VXK7
Position
1937269..1938867
Genome map
AA seq 532 aa AA seqDB search
MTTSAPTREIRVLAAPGDRHGEILTPAALDFVGKLAAAFGERRQWLLKERRRQAIRLATG
SPLDFPVTTSGVRADRAWRVAPPAPGLTDRRVEITGPPERRMAVNALNSGARVWRADFED
ATAPTWDNVIGGQLVLLDAIERRIDFTTPEGKEYRLGEHPATIMVRPRGWHLDEAHLELD
GRPVPASLVDFGLYFFHCAQRQIDAGYGPYFSLPKLENHYEARLWNDVFLLAQELLGIPR
GTVRATVLIETITAAFQMEEILHELREHSAGLSAGRWDYLFSLIKTFGHRTDFLLPDRAK
VTMTAPFMRAYTELLVRTCHRRGAHAIGGMAAQVPGKDPAANEAALAKVRLDKEREAEDG
FDGSWVAHPGLVPVCLEVFDGVLGGLPEQIHRTRDDVAATAADLLSVRRISGPPTAEGVR
TNIAVALRYFDAWLRGQGAVAIDGLMEDAATAEIARVQIWQWLRHRVIEREEVLLVLDEE
LARVGAEYPWAALDEIRALFERTALAPELPLFFTPEAYTRRLVRTTTSEATA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagcgccccgacccgtgagatccgtgtcctggccgcccccggtgaccgccac
ggtgagatcctcacccccgccgccctcgacttcgtcggcaagctggccgccgccttcggc
gagcgccgccagtggctcctgaaagagcgccgccggcaggccatccggctcgccaccggt
tccccgctcgacttcccggtcaccacctcgggcgtccgcgcggaccgtgcctggcgggtg
gccccgcccgcacccgggctgaccgaccgcagggtcgagatcaccggcccgcccgagcgc
cgcatggccgtgaacgcgctcaactccggagcgcgcgtgtggagggcggacttcgaggac
gccaccgcgccaacctgggacaacgtcatcggcgggcagctggtcctgctcgacgcgatc
gagcggcgcatcgacttcaccacgccggagggcaaggagtaccgcctcggggagcacccc
gccaccatcatggtccggccgcgcggctggcacctcgacgaggcgcacctggagctcgac
ggccgtcccgtccccgcctcccttgtcgacttcggcctgtacttcttccactgcgcgcag
cggcagatcgacgccgggtacggcccgtacttctccctccccaagctggagaaccactac
gaggcccggctgtggaacgacgtgttcctcctcgcccaggagctcctgggcatcccccgg
ggcacggtccgcgccaccgtcctgatcgagacgatcaccgccgccttccagatggaggag
atcctccacgaactccgcgagcacagcgcgggcctcagcgccgggcgctgggactacctg
ttcagcctgatcaagaccttcggccaccgcaccgacttcctcctccccgaccgggcgaag
gtcaccatgaccgcgcccttcatgcgggcgtacaccgaactcctggtccgcacctgccac
cggcgcggcgcccacgccatcggcggcatggcagcccaggtccccggcaaggacccggcg
gcgaacgaggccgccctcgccaaggtgcggctcgacaaggagcgggaggccgaggacggc
ttcgacggctcctgggtcgcccacccgggcctcgtcccggtctgcctggaagtcttcgac
ggtgtcctgggcggccttccggagcagatccaccggacccgtgacgacgtggcggccacg
gcggcggacctgctctccgtgcgccgcatcagcggcccgcccacggccgagggggtgcgc
accaacatcgccgtggccctgcgctacttcgacgcctggctgcgcgggcagggagccgtc
gccatcgacgggctgatggaggacgccgccaccgccgagatcgcccgcgtccagatctgg
cagtggctgcgccaccgggtcatcgaacgggaggaggtgctcctggtcctcgacgaggag
ctggcccgggtcggcgcggagtacccgtgggccgcgctcgacgagatccgcgcgctgttc
gagaggaccgcgctcgcgccggaactgccgctgttcttcacccccgaggcgtacacgcgc
cgcctcgtccggaccaccacctcggaagcgacggcatga

DBGET integrated database retrieval system