KEGG   Streptomyces griseus: SGR_1644Help
Entry
SGR_1644          CDS       T00691                                 

Gene name
aceB2
Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sgr  Streptomyces griseus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sgr01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sgr00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:sgr00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
1937269..1938867
Genome map
AA seq 532 aa AA seqDB search
MTTSAPTREIRVLAAPGDRHGEILTPAALDFVGKLAAAFGERRQWLLKERRRQAIRLATG
SPLDFPVTTSGVRADRAWRVAPPAPGLTDRRVEITGPPERRMAVNALNSGARVWRADFED
ATAPTWDNVIGGQLVLLDAIERRIDFTTPEGKEYRLGEHPATIMVRPRGWHLDEAHLELD
GRPVPASLVDFGLYFFHCAQRQIDAGYGPYFSLPKLENHYEARLWNDVFLLAQELLGIPR
GTVRATVLIETITAAFQMEEILHELREHSAGLSAGRWDYLFSLIKTFGHRTDFLLPDRAK
VTMTAPFMRAYTELLVRTCHRRGAHAIGGMAAQVPGKDPAANEAALAKVRLDKEREAEDG
FDGSWVAHPGLVPVCLEVFDGVLGGLPEQIHRTRDDVAATAADLLSVRRISGPPTAEGVR
TNIAVALRYFDAWLRGQGAVAIDGLMEDAATAEIARVQIWQWLRHRVIEREEVLLVLDEE
LARVGAEYPWAALDEIRALFERTALAPELPLFFTPEAYTRRLVRTTTSEATA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagcgccccgacccgtgagatccgtgtcctggccgcccccggtgaccgccac
ggtgagatcctcacccccgccgccctcgacttcgtcggcaagctggccgccgccttcggc
gagcgccgccagtggctcctgaaagagcgccgccggcaggccatccggctcgccaccggt
tccccgctcgacttcccggtcaccacctcgggcgtccgcgcggaccgtgcctggcgggtg
gccccgcccgcacccgggctgaccgaccgcagggtcgagatcaccggcccgcccgagcgc
cgcatggccgtgaacgcgctcaactccggagcgcgcgtgtggagggcggacttcgaggac
gccaccgcgccaacctgggacaacgtcatcggcgggcagctggtcctgctcgacgcgatc
gagcggcgcatcgacttcaccacgccggagggcaaggagtaccgcctcggggagcacccc
gccaccatcatggtccggccgcgcggctggcacctcgacgaggcgcacctggagctcgac
ggccgtcccgtccccgcctcccttgtcgacttcggcctgtacttcttccactgcgcgcag
cggcagatcgacgccgggtacggcccgtacttctccctccccaagctggagaaccactac
gaggcccggctgtggaacgacgtgttcctcctcgcccaggagctcctgggcatcccccgg
ggcacggtccgcgccaccgtcctgatcgagacgatcaccgccgccttccagatggaggag
atcctccacgaactccgcgagcacagcgcgggcctcagcgccgggcgctgggactacctg
ttcagcctgatcaagaccttcggccaccgcaccgacttcctcctccccgaccgggcgaag
gtcaccatgaccgcgcccttcatgcgggcgtacaccgaactcctggtccgcacctgccac
cggcgcggcgcccacgccatcggcggcatggcagcccaggtccccggcaaggacccggcg
gcgaacgaggccgccctcgccaaggtgcggctcgacaaggagcgggaggccgaggacggc
ttcgacggctcctgggtcgcccacccgggcctcgtcccggtctgcctggaagtcttcgac
ggtgtcctgggcggccttccggagcagatccaccggacccgtgacgacgtggcggccacg
gcggcggacctgctctccgtgcgccgcatcagcggcccgcccacggccgagggggtgcgc
accaacatcgccgtggccctgcgctacttcgacgcctggctgcgcgggcagggagccgtc
gccatcgacgggctgatggaggacgccgccaccgccgagatcgcccgcgtccagatctgg
cagtggctgcgccaccgggtcatcgaacgggaggaggtgctcctggtcctcgacgaggag
ctggcccgggtcggcgcggagtacccgtgggccgcgctcgacgagatccgcgcgctgttc
gagaggaccgcgctcgcgccggaactgccgctgttcttcacccccgaggcgtacacgcgc
cgcctcgtccggaccaccacctcggaagcgacggcatga

DBGET integrated database retrieval system