KEGG   Streptomyces griseus: SGR_1644Help
Entry
SGR_1644          CDS       T00691                                 

Gene name
aceB2
Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sgr  Streptomyces griseus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGR_1644 (aceB2)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SGR_1644 (aceB2)
   00630 Glyoxylate and dicarboxylate metabolism
    SGR_1644 (aceB2)
Enzymes [BR:sgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SGR_1644 (aceB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
1937269..1938867
Genome map
AA seq 532 aa AA seqDB search
MTTSAPTREIRVLAAPGDRHGEILTPAALDFVGKLAAAFGERRQWLLKERRRQAIRLATG
SPLDFPVTTSGVRADRAWRVAPPAPGLTDRRVEITGPPERRMAVNALNSGARVWRADFED
ATAPTWDNVIGGQLVLLDAIERRIDFTTPEGKEYRLGEHPATIMVRPRGWHLDEAHLELD
GRPVPASLVDFGLYFFHCAQRQIDAGYGPYFSLPKLENHYEARLWNDVFLLAQELLGIPR
GTVRATVLIETITAAFQMEEILHELREHSAGLSAGRWDYLFSLIKTFGHRTDFLLPDRAK
VTMTAPFMRAYTELLVRTCHRRGAHAIGGMAAQVPGKDPAANEAALAKVRLDKEREAEDG
FDGSWVAHPGLVPVCLEVFDGVLGGLPEQIHRTRDDVAATAADLLSVRRISGPPTAEGVR
TNIAVALRYFDAWLRGQGAVAIDGLMEDAATAEIARVQIWQWLRHRVIEREEVLLVLDEE
LARVGAEYPWAALDEIRALFERTALAPELPLFFTPEAYTRRLVRTTTSEATA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagcgccccgacccgtgagatccgtgtcctggccgcccccggtgaccgccac
ggtgagatcctcacccccgccgccctcgacttcgtcggcaagctggccgccgccttcggc
gagcgccgccagtggctcctgaaagagcgccgccggcaggccatccggctcgccaccggt
tccccgctcgacttcccggtcaccacctcgggcgtccgcgcggaccgtgcctggcgggtg
gccccgcccgcacccgggctgaccgaccgcagggtcgagatcaccggcccgcccgagcgc
cgcatggccgtgaacgcgctcaactccggagcgcgcgtgtggagggcggacttcgaggac
gccaccgcgccaacctgggacaacgtcatcggcgggcagctggtcctgctcgacgcgatc
gagcggcgcatcgacttcaccacgccggagggcaaggagtaccgcctcggggagcacccc
gccaccatcatggtccggccgcgcggctggcacctcgacgaggcgcacctggagctcgac
ggccgtcccgtccccgcctcccttgtcgacttcggcctgtacttcttccactgcgcgcag
cggcagatcgacgccgggtacggcccgtacttctccctccccaagctggagaaccactac
gaggcccggctgtggaacgacgtgttcctcctcgcccaggagctcctgggcatcccccgg
ggcacggtccgcgccaccgtcctgatcgagacgatcaccgccgccttccagatggaggag
atcctccacgaactccgcgagcacagcgcgggcctcagcgccgggcgctgggactacctg
ttcagcctgatcaagaccttcggccaccgcaccgacttcctcctccccgaccgggcgaag
gtcaccatgaccgcgcccttcatgcgggcgtacaccgaactcctggtccgcacctgccac
cggcgcggcgcccacgccatcggcggcatggcagcccaggtccccggcaaggacccggcg
gcgaacgaggccgccctcgccaaggtgcggctcgacaaggagcgggaggccgaggacggc
ttcgacggctcctgggtcgcccacccgggcctcgtcccggtctgcctggaagtcttcgac
ggtgtcctgggcggccttccggagcagatccaccggacccgtgacgacgtggcggccacg
gcggcggacctgctctccgtgcgccgcatcagcggcccgcccacggccgagggggtgcgc
accaacatcgccgtggccctgcgctacttcgacgcctggctgcgcgggcagggagccgtc
gccatcgacgggctgatggaggacgccgccaccgccgagatcgcccgcgtccagatctgg
cagtggctgcgccaccgggtcatcgaacgggaggaggtgctcctggtcctcgacgaggag
ctggcccgggtcggcgcggagtacccgtgggccgcgctcgacgagatccgcgcgctgttc
gagaggaccgcgctcgcgccggaactgccgctgttcttcacccccgaggcgtacacgcgc
cgcctcgtccggaccaccacctcggaagcgacggcatga

DBGET integrated database retrieval system