KEGG   Streptomyces griseus: SGR_1644Help
Entry
SGR_1644          CDS       T00691                                 

Gene name
aceB2
Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sgr  Streptomyces griseus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGR_1644 (aceB2)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SGR_1644 (aceB2)
   00630 Glyoxylate and dicarboxylate metabolism
    SGR_1644 (aceB2)
Enzymes [BR:sgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SGR_1644 (aceB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
1937269..1938867
Genome map
AA seq 532 aa AA seqDB search
MTTSAPTREIRVLAAPGDRHGEILTPAALDFVGKLAAAFGERRQWLLKERRRQAIRLATG
SPLDFPVTTSGVRADRAWRVAPPAPGLTDRRVEITGPPERRMAVNALNSGARVWRADFED
ATAPTWDNVIGGQLVLLDAIERRIDFTTPEGKEYRLGEHPATIMVRPRGWHLDEAHLELD
GRPVPASLVDFGLYFFHCAQRQIDAGYGPYFSLPKLENHYEARLWNDVFLLAQELLGIPR
GTVRATVLIETITAAFQMEEILHELREHSAGLSAGRWDYLFSLIKTFGHRTDFLLPDRAK
VTMTAPFMRAYTELLVRTCHRRGAHAIGGMAAQVPGKDPAANEAALAKVRLDKEREAEDG
FDGSWVAHPGLVPVCLEVFDGVLGGLPEQIHRTRDDVAATAADLLSVRRISGPPTAEGVR
TNIAVALRYFDAWLRGQGAVAIDGLMEDAATAEIARVQIWQWLRHRVIEREEVLLVLDEE
LARVGAEYPWAALDEIRALFERTALAPELPLFFTPEAYTRRLVRTTTSEATA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagcgccccgacccgtgagatccgtgtcctggccgcccccggtgaccgccac
ggtgagatcctcacccccgccgccctcgacttcgtcggcaagctggccgccgccttcggc
gagcgccgccagtggctcctgaaagagcgccgccggcaggccatccggctcgccaccggt
tccccgctcgacttcccggtcaccacctcgggcgtccgcgcggaccgtgcctggcgggtg
gccccgcccgcacccgggctgaccgaccgcagggtcgagatcaccggcccgcccgagcgc
cgcatggccgtgaacgcgctcaactccggagcgcgcgtgtggagggcggacttcgaggac
gccaccgcgccaacctgggacaacgtcatcggcgggcagctggtcctgctcgacgcgatc
gagcggcgcatcgacttcaccacgccggagggcaaggagtaccgcctcggggagcacccc
gccaccatcatggtccggccgcgcggctggcacctcgacgaggcgcacctggagctcgac
ggccgtcccgtccccgcctcccttgtcgacttcggcctgtacttcttccactgcgcgcag
cggcagatcgacgccgggtacggcccgtacttctccctccccaagctggagaaccactac
gaggcccggctgtggaacgacgtgttcctcctcgcccaggagctcctgggcatcccccgg
ggcacggtccgcgccaccgtcctgatcgagacgatcaccgccgccttccagatggaggag
atcctccacgaactccgcgagcacagcgcgggcctcagcgccgggcgctgggactacctg
ttcagcctgatcaagaccttcggccaccgcaccgacttcctcctccccgaccgggcgaag
gtcaccatgaccgcgcccttcatgcgggcgtacaccgaactcctggtccgcacctgccac
cggcgcggcgcccacgccatcggcggcatggcagcccaggtccccggcaaggacccggcg
gcgaacgaggccgccctcgccaaggtgcggctcgacaaggagcgggaggccgaggacggc
ttcgacggctcctgggtcgcccacccgggcctcgtcccggtctgcctggaagtcttcgac
ggtgtcctgggcggccttccggagcagatccaccggacccgtgacgacgtggcggccacg
gcggcggacctgctctccgtgcgccgcatcagcggcccgcccacggccgagggggtgcgc
accaacatcgccgtggccctgcgctacttcgacgcctggctgcgcgggcagggagccgtc
gccatcgacgggctgatggaggacgccgccaccgccgagatcgcccgcgtccagatctgg
cagtggctgcgccaccgggtcatcgaacgggaggaggtgctcctggtcctcgacgaggag
ctggcccgggtcggcgcggagtacccgtgggccgcgctcgacgagatccgcgcgctgttc
gagaggaccgcgctcgcgccggaactgccgctgttcttcacccccgaggcgtacacgcgc
cgcctcgtccggaccaccacctcggaagcgacggcatga

DBGET integrated database retrieval system