KEGG   Streptomyces griseus: SGR_186Help
Entry
SGR_186           CDS       T00691                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sgr  Streptomyces griseus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SGR_186
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SGR_186
Enzymes [BR:sgr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     SGR_186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
189999..191474
Genome map
AA seq 491 aa AA seqDB search
MKLSDLIAGQDHHALRGTPDRTNVTAGVTIDADRVTPGSVFAAVPGHAAGGPHAVAPAVA
RGAVAVLVDEQAPTLPAAMGDVCVLRVPDVRKAAAVVASRYFGEPGRAMDLIAITGTNGK
TSVSYMTESVLRLAERARVGVIGTAGSRIGDEVIPMPPSVLSTPESPDLQYLLGHMRDRA
CGSVVLEATSMGLLTHRLDRTFIDVGVFTNLTQDHLDDHGTMENYRDAKLRLFQGLCRRA
VVNADDPVGAGIRKLMPGAVTTYALDGDADYRASDLAVDASGSRFTLHHDGRKYPAAIPS
PGRFSVSNALATVAACHLLGHGLAGLVDALERMPQIPGRFERLQIPGGTSVIVDYAHSPD
SLNKVLTTIRGFARGRVITVFGCGGDRDTTKRADMGAIAGTHSDLCVLTSDNPRYEDPEG
ILDQIAKGIVSTGTPFERLTDRRSAIAAALGEAGPDDVVLIAGKGSEPHQSVRGELLPFS
DMATVRELIGA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctgagcgacctcatcgcgggacaggaccaccatgcgctgcggggcacccccgac
cgcacgaacgtcaccgccggcgtgacgatcgacgcggaccgggtcacccccggctccgtc
ttcgccgctgtgcccggccatgccgccggcggcccgcacgcagtcgcccccgccgtcgcg
cgcggcgcggtcgcggtgctcgtcgacgaacaggcgcctaccctgcccgcggcaatgggc
gacgtgtgcgtcctacgcgtccctgatgtccgcaaggccgccgcggtggtggcctcgcgc
tacttcggcgaaccgggccgggcgatggatctgatcgccatcaccggcaccaacggaaag
acatccgtctcgtacatgaccgagtcggtgctgcggctcgccgagcgggcccgggtcgga
gtgatcggcactgcgggcagccggatcggggacgaggtcatcccgatgccgccatcggtg
ctcagcactccggaatcgcccgatctccagtacctgttggggcacatgcgtgaccgggcg
tgcggaagcgtcgtcctggaggccacgtcgatggggctgctgacgcaccgcctggaccgg
acgttcatcgacgtcggcgtcttcaccaacctgacccaggaccacctcgacgaccacggc
accatggagaactaccgggacgccaaactccgcctcttccagggcctttgccgacgcgcc
gtggtcaacgccgacgacccggtgggtgccgggatccggaagctgatgcccggcgcggtg
accacatacgcgctggacggcgacgcggactaccgcgcgagcgacctcgccgtcgatgcc
tcgggttcccgtttcacgctgcaccacgacggccgcaagtatccggcggccatcccgtcg
ccgggccggttctccgtctcgaacgcgctggccacggtggccgcgtgccacctcttgggc
catggtctggccgggctggtggacgccctggagcggatgccgcagatccccggccgcttc
gagcgcctccagatccccgggggtacctcggtgatcgtggactacgctcactcgccggac
tccctcaacaaggtcctcaccaccatccggggcttcgcccggggccgggtcatcaccgtg
ttcggctgtggcggcgaccgcgacaccaccaagcgcgccgatatgggcgcgatcgcgggc
acccactccgacctgtgcgttctcacctccgacaacccccgttacgaggaccccgagggc
attctcgaccagatcgcgaagggcatcgtgtcgaccgggacgccgttcgagcggctgacc
gaccgccgctcggccatcgccgccgcactgggggaggcggggccggacgacgtcgtgctc
atcgcgggcaagggcagcgaacctcaccagagcgtccggggcgagctgctccccttcagc
gacatggccaccgtgcgtgagctgatcggcgcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system