KEGG   Streptomyces griseus: SGR_2101Help
Entry
SGR_2101          CDS       T00691                                 

Gene name
glgB
Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sgr  Streptomyces griseus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SGR_2101 (glgB)
Enzymes [BR:sgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SGR_2101 (glgB)
Exosome [BR:sgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SGR_2101 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
2494733..2497111
Genome map
AA seq 792 aa AA seqDB search
MTARKPSRKGSRKTAEPPVEIPVEASVDVAAAPATASTTTKAARAGRARPRPADAGPPRP
RAGDGQGARPAPALDGADRGRLLAGDHHAPHDVLGAHPIPGGVLVRALRPFARSVTVLAT
GLRAELHEDGDGFFSGVLPVPEVPAYRLEVAYDDNTIEVEDAYRFWPAIGELDLHLIGEG
RHEELWRALGAEPMEHQGVSGTRFTLWAPNARGVRVTGDFNYWDGTGYPMRSLGSTGVWE
LFLPGVGEGALYKYDVCRPDGSHTVRADPMARRTEVPPATASVVTASHHVWQDADWMAHR
GDRPVHEAPFSVYEVHLASWRPGLTYRQLAEQLPAYVKDLGFTHVELMPVSEHPFGGSWG
YQVTGFYAPTSRMGTPDDFRFLVDALHRAGIGVIMDWVPAHFPRDDWALAEFDGRPLYEH
ADPRRAAHPDWGTLEFDYGRTEVRNFLVANATYWCEEFHIDGLRVDAVASMLYLDYSREE
GQWSPNEFGGRENLDAVAFLQEMNATVYRRNPGVVTIAEESTAWDGVTRPTDSGGLGFGL
KWNMGWMHDSLQYVAKEPVHRKYHHNEMTFSMVYAYSENYVLPISHDEVVHGKQALVSKM
PGDWWQRRANHRAYLGFMWAHPGKQLLFMGQEFAQGAEWSEGHGPDWWLLDPSYEASGDH
RGVRTLVGDLNAVYGAVPALWQRDTVPEGFSWVDGGAAEDNVFAFLRYDADGSPLLAVSH
FSPAVRADYRLGVPETGAEGWVEVLNTDAARYGGGDVRNEEPLKAEAVPAHGRPCSVSLT
LPPLATVWFRPA
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcccgcaagccgtcccgcaagggatcccgcaagaccgccgaaccgcccgtcgag
atccccgtcgaggcgtccgtcgacgtggcggctgcgcccgcgaccgcctcgaccaccacg
aaggccgcgcgtgccgggcgggccaggccccggcccgccgacgcggggccgccgcgcccc
cgggccggggacggccagggcgcccgccccgcgccggccctggacggcgcggaccgcggc
cggctgctggccggcgaccaccacgcgccgcacgacgtgctcggcgcccacccgatcccc
ggcggcgtgctggtacgggcgctgcggccgttcgccaggtcggtcacggtgctggcgacc
gggctgcgggccgaactgcacgaggacggcgacggcttcttctccggcgtgctcccggtg
ccggaggtccccgcgtaccggctggaagtggcgtacgacgacaacaccatcgaggtggag
gacgcgtaccgcttctggcccgcgatcggggagctcgatctgcacctgatcggcgagggc
cggcacgaggagctgtggcgggcgctcggcgcggagccgatggagcaccagggcgtttcc
ggcacccggttcaccctctgggcgccgaacgcccgcggggtgcgggtcaccggtgacttc
aactactgggacggcacgggctacccgatgcgttcgctcggctcgaccggggtgtgggag
ctgttcctgcccggggtcggcgagggcgccctgtacaagtacgacgtctgccgcccggac
ggttcgcacacggtgcgggccgacccgatggcccggcgcaccgaggtgccgcccgcgacc
gcctcggtcgtcaccgcgtcgcaccacgtgtggcaggacgccgactggatggcgcaccgg
ggcgaccggccggtgcacgaggccccgttctccgtgtacgaggtgcatctcgcctcctgg
cggccgggcttgacgtaccgtcagctcgccgagcagctgcccgcgtacgtcaaggacctc
gggttcacgcacgtcgagctgatgccggtctccgagcaccccttcggcggctcctggggc
tatcaggtcaccgggttctacgcgccgacgtcgcggatgggcaccccggacgacttccgc
ttcctcgtcgacgccctgcaccgggcgggtatcggcgtcatcatggactgggtcccggcc
catttcccgcgcgacgactgggcgttggccgagttcgacgggcgtccgctgtacgagcac
gccgacccgcggcgcgcggcgcacccggactgggggacgctggagttcgactacggccgc
accgaggtccgcaacttcctcgtcgccaacgccacctactggtgcgaggagttccacatc
gacgggctgcgggtcgacgcggtcgcctcgatgctctacctcgactactcccgcgaggaa
ggccagtggtcgcccaacgagttcggcggccgggagaacctggacgcggtcgccttcctc
caggagatgaacgcgaccgtctaccggcgcaacccgggcgtcgtcacgatcgccgaggag
tccaccgcctgggacggtgtcacccggcccaccgacagcggcggcctgggcttcgggctg
aagtggaacatgggctggatgcacgactcgctccagtacgtcgccaaggagccggtccac
cgcaagtaccaccacaacgagatgacgttctcgatggtgtacgcctacagcgagaactac
gtgctgccgatctcgcacgacgaggtggtgcacggcaagcaggcgctggtgagcaagatg
cccggcgactggtggcagcggcgtgccaaccaccgcgcctacctgggcttcatgtgggcc
catcccggcaagcagctcctgttcatgggccaggagttcgcccagggcgcggagtggtcc
gaggggcacgggccggactggtggctgctggacccgtcctacgaggcgtccggcgaccac
cgcggggtgcggaccctggtgggcgatctgaacgcggtgtacggggcggtgcccgcgctg
tggcagcgggacaccgttccggaggggttcagctgggtggacggcggggcggccgaggac
aacgtgttcgcgttcctgcggtacgacgcggacggctccccgctgctggcggtctcgcac
ttctccccggcggtccgcgccgactaccgcctcggggtgccggagaccggcgccgagggc
tgggtggaggtcctgaacaccgacgcggcccggtacggcggcggggacgtgcgcaacgag
gagccgctgaaggcggaggcggtgcccgcgcacggccggccgtgcagcgtctcgctcacg
ctgccgccgctggcgacggtgtggttccgcccggcgtag

DBGET integrated database retrieval system