KEGG   Streptomyces griseus: SGR_2110Help
Entry
SGR_2110          CDS       T00691                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sgr  Streptomyces griseus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGR_2110
   01230 Biosynthesis of amino acids
    SGR_2110
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGR_2110
   00030 Pentose phosphate pathway
    SGR_2110
   00051 Fructose and mannose metabolism
    SGR_2110
   00052 Galactose metabolism
    SGR_2110
  Energy metabolism
   00680 Methane metabolism
    SGR_2110
Enzymes [BR:sgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SGR_2110
Protein phosphatases and associated proteins [BR:sgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SGR_2110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(2505576..2506601)
Genome map
AA seq 341 aa AA seqDB search
MRIGILTAGGDCPGLNAVIRSVVHRAVVGHGDEVIGFEDGFKGLLDGHFRPLDLNAVSGI
LARGGTILGSARLERDRLREAAENCEELSRRYGIDALIPIGGEGTLTAARMLSDAGMPVV
GVPKTIDNDISSTDRTFGFDTAVGVATEAIDRLKTTAESHQRVMVVEVMGRHAGWIALES
GMAGGAHGICLPERPFQVDDLVKMVEERFARGKKFAVICVAEGAHPAEGSMPYAKGEIDQ
YGHERFQGIGNRLAIELETRLGKEARPVILGHVQRGGTPTAYDRVLATRFGWHAVEAVHR
GDFGRMTALRGNDIAMVPLAEAVTQLKRVPAERMYEAESVF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggaattctcaccgcgggcggcgactgccccggcctgaacgcagtgatccgg
tcggtcgtccaccgggccgtggtcggccacggcgacgaggtcatcggcttcgaggacggc
ttcaaggggctgctcgacggccacttccgccccctcgacctcaacgcggtcagcggcatc
ctcgcccgcggcggcaccatcctcggctcggcccgcctggagcgcgaccggctgcgcgag
gccgccgagaactgcgaggagctgtcccgccgttacggcatcgacgcgctcatcccgatc
ggcggcgagggcacgctcaccgcggcccgcatgctctccgacgcgggcatgccggtcgtc
ggcgtcccgaagaccatcgacaacgacatctcctccaccgaccggaccttcgggttcgac
acggcggtgggcgtcgccacggaggccatagaccgtctcaagaccaccgccgagtcccac
cagcgcgtgatggtcgtcgaggtcatgggccggcacgcgggatggatcgcgctggagtcc
ggcatggccggcggcgcccacggcatctgcctgcccgagcgccccttccaggtcgacgac
ctggtcaagatggtcgaggaacggttcgcgcgcggcaagaagttcgccgtcatctgcgtc
gccgagggcgcgcacccggcggagggctccatgccgtacgccaagggcgagatcgaccag
tacggccacgagcgcttccagggcatcggcaaccgcctggccatcgagctggagacccgg
ctcggcaaggaggcccggccggtcattctcggccacgtccagcgcggcggcacgccgacc
gcgtacgaccgggtgctcgccacccgcttcggctggcacgccgtggaggccgtgcaccgc
ggcgacttcggccggatgaccgccctgcgcggcaacgacatcgccatggtcccgctcgcc
gaggccgtcacccagctgaagcgggtgcccgccgagcggatgtacgaggcggagtcggtc
ttctag

DBGET integrated database retrieval system