KEGG   Streptomyces griseus: SGR_2181Help
Entry
SGR_2181          CDS       T00691                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sgr  Streptomyces griseus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SGR_2181
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGR_2181
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SGR_2181
Enzymes [BR:sgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SGR_2181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(2582873..2583943)
Genome map
AA seq 356 aa AA seqDB search
MTSKGTHQWRGIIEEYRDRLPVTATTPVVTLREGGTPLVPAQVLSERTGCEVHLKVEGAN
PTGSFKDRGMTMAITRAKEEGAKAVICASTGNTSASAAAYAVRAGMVCAVLVPQGKIALG
KMGQALVHGARILQVDGNFDDCLTLARSLSDNYPVALVNSVNPVRIEGQKTAAFEIVDAL
GDAPDIHVLPVGNAGNITAYWKGYTEYAGDGVSTRSPRMWGFQASGSAPIVRGEVVKDPS
TIATAIRIGNPASWNYALAARDESGGFIDEVTDRQILSAYRLLASQEGVFVEPASAASVA
GLLKAAEEGKVDPGQRIVCTVTGNGLKDPDWAVAGAPQPVTVPVDAAAAAEKLGLA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaagggcacccaccagtggcgcggcatcatcgaggagtaccgggaccggctt
ccggtcacggcgacgacaccggtcgtcacgcttcgtgagggcggtacgccgctcgtaccg
gcgcaggtcctctccgagcgcacgggctgcgaggtgcacctcaaggtcgagggcgccaac
cccaccggttcgttcaaggaccgcggcatgaccatggccatcacccgggccaaggaggag
ggcgcgaaggccgtcatctgcgcctccaccggcaacacgtcggcctccgccgcggcgtac
gcggtgcgcgcggggatggtctgcgccgtcctcgtaccgcagggcaagatcgcgctcggc
aagatgggccaggccctcgtgcacggcgccaggatcctccaggtcgacggcaacttcgac
gactgcctgaccctggcccgctcgctctcggacaactacccggtggcgctggtcaattcg
gtcaatccggtccgtatcgagggccagaagaccgccgcgttcgagatcgtcgacgcgctc
ggcgacgcccccgacatccacgtcctgccggtcggcaacgcgggcaacatcaccgcgtac
tggaaggggtacaccgagtacgccggggacggcgtctcgacccgttccccgcgcatgtgg
ggattccaggcctccggctccgcgcccatcgtgcgcggcgaggtcgtcaaggacccgtcg
accatcgccaccgcgatccgcatcggcaacccggcctcctggaactacgcgctggccgcg
cgcgacgagtcgggcggcttcatcgacgaggtgacggaccggcagatcctgtccgcgtac
cggctgttggcctcccaggagggcgtcttcgtggagcccgcctcggccgcatccgtcgcc
ggcctgctcaaggccgccgaggagggcaaggtcgaccccggccagcgcatcgtctgcacg
gtcaccggaaacggcctcaaggaccccgactgggccgtcgcgggcgcaccgcagccggtc
accgtccccgtcgacgcggccgccgccgccgagaagctcggtctggcctga

DBGET integrated database retrieval system