KEGG   Streptomyces griseus: SGR_2278Help
Entry
SGR_2278          CDS       T00691                                 

Definition
sugar hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sgr  Streptomyces griseus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sgr00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sgr00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(2694028..2695557)
Genome map
AA seq 509 aa AA seqDB search
MTTLVSTTDTLTRDALAVLQPGFTGTTAPDWLLRRVGEGLASVGLFGRNITSPEQLSALT
ERLRSEREDVLVAIDEEGGDVTRLEVTHGSSFPGNFALGSVDDVDLTRAVAQELGRRLAE
CGVNLNWAPSADVNSNPGNPVIGVRSFGADTRLAARHTAAYIEGLQAAGVAACTKHFPGH
GDTAVDSHLALPRIDVDLDTLHARELVPFRAAIAAGSKSVMSAHILLPALDPDRPATLSP
QILTGLLRQELGYDGLIVTDAVEMDAIAGTYGIERGSVLALAAGADAICVGGGLADEETV
LRLRDALVAAVRSGDLTEERLADAAARVRALASWTQRVRGDIRESGAAVQEGTAPGTGVS
SDIGLVAARRAVRVTGSGDRLTGASYVASFSAVANIAVGDETPWGIAAELERILPGTGSD
TYTDQSTAPADAILAAAGERRIVAVVRDEHRHAWMGAALDALLAARPDTIVVEMGLPQSD
PRGSLHIATHGAARVCGLAAAEAITGTKA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccctcgtttccaccacggacaccctgacacgtgacgcgctcgcggtgctccag
cccgggttcaccggcaccaccgcgccggactggctgctgcgccgcgtcggcgaggggctc
gcctccgtcggcctgttcggccgcaacatcacctcgccggagcagctctccgccctcacc
gagcggctgcgctccgagcgggaggacgtcctcgtcgccatcgacgaggagggcggcgac
gtgacccgcctggaggtcacgcacggctcctccttccccggcaacttcgcgctgggctcg
gtggacgacgtcgacctcacccgggccgtcgcccaggagctcggccgccgcctcgccgag
tgcggcgtcaacctcaactgggcgccgtccgccgacgtcaactccaacccgggcaacccg
gtcatcggcgtgcgctccttcggcgccgacacccggctcgccgcccggcacaccgccgcg
tacatcgaggggctccaggccgccggcgtcgccgcctgcaccaagcacttccccggacac
ggcgacaccgcggtggactcgcacctggcgctgccccgcatcgatgtggatctcgacacc
ctgcacgcccgtgaactggtgcctttccgggccgccatcgcggcgggttccaaatcggtg
atgagcgcgcatatcctgcttcccgcactcgacccggaccgtccggcgaccctgagcccg
cagatcctcaccggtctgctgcgccaggagctgggctacgacggcctgatcgtcaccgac
gccgtggagatggacgccatcgccggtacgtacggcatcgagcgcgggtccgtcctcgcc
ctcgcggcgggcgccgacgccatctgtgtgggcggcggcctggccgacgaggagacggtg
ctgcggctgcgcgacgccctcgtcgcggccgtgcgcagcggggacctgaccgaggagcgg
ctcgccgacgcggccgcccgtgtacgagccctggcgtcctggacgcagagggtccggggg
gacatccgggagtcgggcgcggcagtgcaggaggggaccgcgcccggcaccggagtcagc
tccgacatcggtctggtcgccgcccgccgcgcggtccgggtgaccggctcgggcgaccgg
ctgaccggggcgtcctacgtcgcctcgttcagcgcggtggcgaacatcgcggtcggcgac
gagaccccgtggggcatcgccgccgagctggagcggatcctgcccggcaccggctcggac
acgtacaccgaccagtccaccgccccggcggacgcgatcctggcggctgcgggggagcgg
cgcatcgtcgccgtcgtccgcgacgagcaccggcacgcctggatgggcgccgcgctcgac
gcactgctggcggcccgcccggacacgatcgtggtcgagatgggcctgccgcagtcggac
ccgcgcggctcgctgcacatagcgacccacggagcggcccgcgtctgcggcctggcggcg
gcggaagcgatcaccggtacgaaggcctga

DBGET integrated database retrieval system