KEGG   Streptomyces griseus: SGR_2384Help
Entry
SGR_2384          CDS       T00691                                 

Definition
(GenBank) putative dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
sgr  Streptomyces griseus
Pathway
sgr00790  Folate biosynthesis
sgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SGR_2384
Enzymes [BR:sgr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SGR_2384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: BAG19213
Kitasato: SGR2384
UniProt: B1W1I8
Position
2813132..2814004
Genome map
AA seq 290 aa AA seqDB search
MRSGALRLGRREFGPHEPVIMAIVNRTPDSFYDQGATFRDEPALARVEQAVAEGAAIIDI
GGVKAGPGEEVTAEEEARRTVGFVAEVRRRHPSVVISVDTWRHDVGEAVCEAGADLLNDA
WGGVDPKLAEVAARYGAGLVCTHAGGAEPRTRPHRIAYEDVMADILRVTVGLAERAVELG
VRPDGIMIDPGHDFGKNTRHSLEATRRLEEMADTGWPVLVSLSNKDFVGETLDRPVKERV
IGTLATTAVSAWLGARVYRVHEVAETRQVLDMVASIAGHRPPAVARRGLA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcggtgcactcaggctggggcggcgggaattcggtccgcacgagccggtgatc
atggcgatcgtgaaccggaccccggactccttctacgaccagggcgccacgttccgggac
gagccggcgctcgcccgggtcgagcaggcggtggccgagggcgcggcgatcatcgacatc
ggcggggtgaaggcgggccccggcgaggaggtcaccgccgaggaggaggcgcgccgcacg
gtcgggttcgtcgccgaggtccgccgccgccacccgtccgtggtgatcagcgtggacacc
tggcggcacgacgtgggcgaggcggtctgcgaggccggggcggacctgctgaacgacgcg
tggggcggggtggacccgaagctggcggaggtcgccgcgcggtacggggcggggctcgtg
tgcacgcacgcgggcggcgcggagccgcggacgcgcccgcaccggatcgcgtacgaggac
gtcatggcggacatcctgcgggtgacggtggggctggccgagcgggcggtggagctcggg
gtgcggccggacgggatcatgatcgacccgggtcatgacttcgggaagaacacccggcac
tcgctggaggcgacgcgtcggctcgaggagatggcggatacggggtggccggtgctggtg
tccctgtccaacaaggacttcgtcggggagacgctggaccggccggtgaaggagcgggtc
atcgggacgctggccacgacggcggtgtcggcgtggctgggggcgcgggtgtaccgggtg
cacgaggtggcggagacgcggcaggtcctggacatggtggcgtcgatcgcggggcatcgg
ccgccggcggtcgcgcggcgggggctggcgtag

DBGET integrated database retrieval system