KEGG   Streptomyces griseus: SGR_2445Help
Entry
SGR_2445          CDS       T00691                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sgr  Streptomyces griseus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SGR_2445
Enzymes [BR:sgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SGR_2445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
2883516..2884496
Genome map
AA seq 326 aa AA seqDB search
MRRLLRTLAASAFACLLLPLGAGQQATAATAQADPIGMTSGFYTDPHAAPAAWAAANPGD
GRAAAIRDNIASRPMARWFGAWSGDIGAAVGSYVGAADAADKLPVLIAYNIPGRDACGGH
SGGGAGTPSAYRAWISAFASAIGSRPALVVIEPDSLGDFSCLDQAQIDERNGMLKDALAR
FAAHAPNTWTYLDAGNPAWISAATMAQHLDGAGARQAHGFSLNISNYYGTGENSAYGNAV
NASLSASYGYTKPYVIDTSRNGNGSNGAWCNPGGRRTGAVGQTGGGAEMLLWLKTPGESD
GDCGVGAGSVAGQFLPEVAYKMIYGY
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagaagactcctgcgtacgctcgccgcatcggcgttcgcctgcctcctgctccccctc
ggcgccgggcagcaggccaccgccgccaccgcgcaggccgacccgatcggcatgaccagc
gggttctacaccgacccgcatgcggcccccgccgcctgggccgccgccaaccccggcgac
gggcgggccgccgccatccgcgacaacatcgcctcgcggcccatggcccggtggttcggg
gcgtggagcggggacatcggggcagcggtcggctcctacgtcggtgccgccgacgccgcc
gacaagctgcccgtcctgatcgcgtacaacatccccggccgcgacgcctgcggcgggcac
tccggcggcggcgcgggcactccgagcgcctaccgcgcctggatctccgcgttcgcctcg
gcgatcggctcccggcccgcgctggtggtcatcgagcccgactcgctcggcgacttcagc
tgcctggaccaggcgcagatcgacgagcgcaacgggatgctcaaggacgcgctcgcccgg
ttcgccgcccacgctcccaacacctggacctacctggacgccgggaacccggcctggatc
agcgccgccaccatggcacagcacctcgacggcgcgggggcccggcaggcgcacggcttc
tcgctgaacatctcgaactactacggcaccggcgagaactccgcgtacggcaacgccgtc
aacgcgtccctgtcggcgtcctacggctacacgaagccgtacgtcatcgacaccagccgc
aacgggaacggctccaacggcgcctggtgcaacccgggcgggcgcaggacgggggcggtc
ggccagacgggcggcggcgccgagatgctgctgtggctgaagacccccggggagtccgac
ggcgactgcggagtcggcgccggctcggtggccgggcagttcctgccggaggtcgcctac
aagatgatctacgggtactga

DBGET integrated database retrieval system