KEGG   Streptomyces griseus: SGR_2447Help
Entry
SGR_2447          CDS       T00691                                 

Gene name
melC2-2
Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
sgr  Streptomyces griseus
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    SGR_2447 (melC2-2)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SGR_2447 (melC2-2)
Enzymes [BR:sgr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     SGR_2447 (melC2-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
2885272..2886096
Genome map
AA seq 274 aa AA seqDB search
MTVRKNQANLTAAEKKAFVDAVLEVKRLGVYDEFVLAHRTRFSIDMNTGVYVGHFGPSFL
PWHRKFLIDFENELRKVDASVSIPYWDWTADNTVGSSLWAPAFLGGTGRPLDDQVMDGPF
AHSGGNWTINVSVDSRPFLARNLAHRVPTLPPRSDVDAALAMPTYDSPPFRDGSTGFRSA
LEGSAGYMSMHNRVHTWVWGHMETSVSPNDPVFWLHHAFVDKLWADWHALHPTSAEYLPA
GGTVDVIDLNDTMPPWPNTTPQDMLDHTQFYTYA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtacggaagaaccaggcgaacctcacggcggccgagaagaaggccttcgtcgac
gcggtactggaggtcaaacgcctgggtgtgtacgacgagttcgtgctcgcccaccgcacg
cggttctccatagacatgaacaccggcgtgtacgtgggccacttcgggccgtcgttcctg
ccgtggcaccgcaagttcctcatcgacttcgagaacgagctgcggaaggtcgacgcgtcg
gtctcgatcccctactgggactggaccgccgacaacaccgtcggctcctcgctctgggcc
ccggccttcctcggcggcaccggacgccccctggacgaccaggtgatggacgggcccttc
gcccactccggcggcaactggacgatcaacgtctcggtcgacagccgccccttcctcgcc
cggaatctcgcccaccgcgttcccacgctcccgccccggtccgacgtcgacgcagccctc
gccatgcccacgtacgactctccgcccttccgcgacggctcgacggggttccgctccgcg
ctggagggctccgcgggctacatgagcatgcacaaccgggtgcacacctgggtctggggc
cacatggagacgagcgtctccccgaacgatccggtgttctggctgcaccacgcgttcgtc
gacaagctctgggccgactggcacgcgctccacccgacgagcgccgagtacctccccgcc
ggcgggacggtcgatgtgatcgacctgaacgacaccatgccgccctggccgaacacgacc
ccgcaggacatgctggaccacacgcagttctatacgtacgcctga

DBGET integrated database retrieval system