KEGG   Streptomyces griseus: SGR_2447Help
Entry
SGR_2447          CDS       T00691                                 

Gene name
melC2-2
Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
sgr  Streptomyces griseus
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:sgr00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:sgr00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
2885272..2886096
Genome map
AA seq 274 aa AA seqDB search
MTVRKNQANLTAAEKKAFVDAVLEVKRLGVYDEFVLAHRTRFSIDMNTGVYVGHFGPSFL
PWHRKFLIDFENELRKVDASVSIPYWDWTADNTVGSSLWAPAFLGGTGRPLDDQVMDGPF
AHSGGNWTINVSVDSRPFLARNLAHRVPTLPPRSDVDAALAMPTYDSPPFRDGSTGFRSA
LEGSAGYMSMHNRVHTWVWGHMETSVSPNDPVFWLHHAFVDKLWADWHALHPTSAEYLPA
GGTVDVIDLNDTMPPWPNTTPQDMLDHTQFYTYA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtacggaagaaccaggcgaacctcacggcggccgagaagaaggccttcgtcgac
gcggtactggaggtcaaacgcctgggtgtgtacgacgagttcgtgctcgcccaccgcacg
cggttctccatagacatgaacaccggcgtgtacgtgggccacttcgggccgtcgttcctg
ccgtggcaccgcaagttcctcatcgacttcgagaacgagctgcggaaggtcgacgcgtcg
gtctcgatcccctactgggactggaccgccgacaacaccgtcggctcctcgctctgggcc
ccggccttcctcggcggcaccggacgccccctggacgaccaggtgatggacgggcccttc
gcccactccggcggcaactggacgatcaacgtctcggtcgacagccgccccttcctcgcc
cggaatctcgcccaccgcgttcccacgctcccgccccggtccgacgtcgacgcagccctc
gccatgcccacgtacgactctccgcccttccgcgacggctcgacggggttccgctccgcg
ctggagggctccgcgggctacatgagcatgcacaaccgggtgcacacctgggtctggggc
cacatggagacgagcgtctccccgaacgatccggtgttctggctgcaccacgcgttcgtc
gacaagctctgggccgactggcacgcgctccacccgacgagcgccgagtacctccccgcc
ggcgggacggtcgatgtgatcgacctgaacgacaccatgccgccctggccgaacacgacc
ccgcaggacatgctggaccacacgcagttctatacgtacgcctga

DBGET integrated database retrieval system