KEGG   Streptomyces griseus: SGR_2544Help
Entry
SGR_2544          CDS       T00691                                 

Definition
(GenBank) putative IclR-family transcriptional regulator
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3003143..3003901)
Genome map
AA seq 252 aa AA seqDB search
MSQTVDRALSILPLLAQGPADLGQVAERLGVHKSTALRLLRTLHEHGLVYRQEDQRYRLG
ARLFALAQEAVENLDVREIAHSHLVALNDRCGHTVHLAVYEEQEVLYIDKVESRYPVRMY
SRIGKPVAITVAAVAKLLLADLPEPERRAIAEKLDYPMYTSRSTPGAAAFLKELAVVREQ
GWATDLGGHEESINCIGAPIRGADGRVVAAMSVSAPNVVVTAEELLTLLPLVRRTAETIS
REYSGTTRPKKA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaccgtcgaccgggcactcagcatcctgccgctgctcgcccagggacccgcc
gacctcggccaggtcgccgagcgcctcggcgtccacaagtccacggcgctgcgcctgctg
cgtacgctccacgagcacggcctcgtctaccgccaggaggaccagcgctaccgcctcggc
gcccggctgttcgcgctcgcccaggaagccgtcgagaacctcgacgtccgcgagatcgcc
cactcccacctggtcgcactcaacgaccggtgcggccacaccgtccacctcgccgtgtac
gaggagcaggaagtcctctacatcgacaaggtcgagagccgctacccggtccggatgtac
tcccggatcggcaagcccgtcgcgatcaccgtcgcggccgtcgccaagctgctgctggcc
gacctccccgagcccgagcggcgcgccatcgccgagaagctcgactaccccatgtacacg
tcccgttcgacgccgggcgccgccgcgttcctcaaggagctcgccgtcgtccgcgaacag
ggatgggccaccgacctcggtggccacgaggagtccatcaactgcatcggcgcccccatt
cgcggcgcggacggacgggtcgtcgcggccatgtcggtctccgcgcccaacgtggtcgtc
accgccgaggaactcctcaccctcctcccgttggtccggcgcaccgccgagaccatcagc
cgggagtactccggcaccacccgacccaagaaagcctga

DBGET integrated database retrieval system