KEGG   Streptomyces griseus: SGR_2544Help
Entry
SGR_2544          CDS       T00691                                 

Definition
(GenBank) putative IclR-family transcriptional regulator
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IclR HTH_IclR TrmB MarR_2 MarR HTH_5 Fe_dep_repress Rrf2 HTH_20 HTH_27 HTH_23 Sulfolobus_pRN DUF4423 HTH_28 HTH_38 HTH_Crp_2 HTH_17 ANT HTH_DeoR HTH_47 DUF4166 HTH_36 Replic_Relax
Motif
Other DBs
NCBI-ProteinID: BAG19373
Kitasato: SGR2544
UniProt: B1W2K9
Position
complement(3003143..3003901)
Genome map
AA seq 252 aa AA seqDB search
MSQTVDRALSILPLLAQGPADLGQVAERLGVHKSTALRLLRTLHEHGLVYRQEDQRYRLG
ARLFALAQEAVENLDVREIAHSHLVALNDRCGHTVHLAVYEEQEVLYIDKVESRYPVRMY
SRIGKPVAITVAAVAKLLLADLPEPERRAIAEKLDYPMYTSRSTPGAAAFLKELAVVREQ
GWATDLGGHEESINCIGAPIRGADGRVVAAMSVSAPNVVVTAEELLTLLPLVRRTAETIS
REYSGTTRPKKA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaccgtcgaccgggcactcagcatcctgccgctgctcgcccagggacccgcc
gacctcggccaggtcgccgagcgcctcggcgtccacaagtccacggcgctgcgcctgctg
cgtacgctccacgagcacggcctcgtctaccgccaggaggaccagcgctaccgcctcggc
gcccggctgttcgcgctcgcccaggaagccgtcgagaacctcgacgtccgcgagatcgcc
cactcccacctggtcgcactcaacgaccggtgcggccacaccgtccacctcgccgtgtac
gaggagcaggaagtcctctacatcgacaaggtcgagagccgctacccggtccggatgtac
tcccggatcggcaagcccgtcgcgatcaccgtcgcggccgtcgccaagctgctgctggcc
gacctccccgagcccgagcggcgcgccatcgccgagaagctcgactaccccatgtacacg
tcccgttcgacgccgggcgccgccgcgttcctcaaggagctcgccgtcgtccgcgaacag
ggatgggccaccgacctcggtggccacgaggagtccatcaactgcatcggcgcccccatt
cgcggcgcggacggacgggtcgtcgcggccatgtcggtctccgcgcccaacgtggtcgtc
accgccgaggaactcctcaccctcctcccgttggtccggcgcaccgccgagaccatcagc
cgggagtactccggcaccacccgacccaagaaagcctga

DBGET integrated database retrieval system