KEGG   Streptomyces griseus: SGR_2549Help
Entry
SGR_2549          CDS       T00691                                 

Definition
(GenBank) putative TetR-family transcriptional regulator
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_C TetR_N HTH_IclR
Motif
Other DBs
NCBI-ProteinID: BAG19378
Kitasato: SGR2549
UniProt: B1W2L4
Position
3009237..3010049
Genome map
AA seq 270 aa AA seqDB search
MVVFAGQGDPRRSLSLLWRADAPPTRGGPGPRPRLSVDAIVAAAVALADEEGMGALSMRA
VGDRLGRTAMALYTYVPGKSELLDLMYDAVHAELPRREPDPDDWRGALTAWAGEVLEFYV
RHPWVLQVSQARPVLGPHEYAGLDTLVTLLRATGLPAGAVRRLVGTLFPFVRGSAQAVAD
ARLAAAATGSSDEEWWAARSAALLELVPDFAERFPAVSGLEAEGPVEPYPGNAPEGAEAV
PYPEREARETFRVGLGVLLDGIEAARADRP
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtggtggtcttcgccgggcagggcgatccgcgccgttccctctccctcctgtggcgcgcg
gacgcgccgccgacgcgcggcggtccggggcccagaccccggctgagcgtggacgcgatc
gtggcggcggcggtggcgctcgcggacgaggaggggatgggggccctgtcgatgcgcgcg
gtcggcgaccggctcgggcgcacggcgatggcgctctacacctacgtccccggcaagagc
gagctgctggacctgatgtacgacgcggtgcacgcggagctcccccgccgcgaaccggac
ccggacgactggcggggggcgctcaccgcctgggccggggaggtcctggagttctacgtc
cggcacccctgggtgctccaggtctcgcaggcgcgtccggtgctggggccgcacgaatac
gcgggtctggacaccttggtgaccctgctgcgggcgacgggactgccggccggggcggtg
cggcggctggtgggaaccctgttcccgttcgtccggggctcggcgcaggcggtggccgac
gcccggctcgccgcggcggcgaccgggagctccgacgaggagtggtgggcggcgcgctcg
gcggccctgctggagctggtcccggacttcgcggagcgcttcccggcggtgagcggcctg
gaggcggaggggccggtggagccgtacccgggaaacgctccggagggcgccgaggcggtg
ccgtacccggagcgggaggcgcgcgagacgttccgggtggggctcggggtgctgctggac
ggcatcgaggcggcgcgcgcggaccggccctga

DBGET integrated database retrieval system