KEGG   Streptomyces griseus: SGR_2550Help
Entry
SGR_2550          CDS       T00691                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin_2
Motif
Other DBs
NCBI-ProteinID: BAG19379
Kitasato: SGR2550
UniProt: B1W2L5
Position
complement(3010092..3010958)
Genome map
AA seq 288 aa AA seqDB search
MNKPLVGAFLAALLLGAGAAPVAQAAPAPQPQTREAAPQADPAAKAVTFAGTVALSNCSG
SVVRSPDAAPTDPALVLSNGHCLESGFPGPGEVVVDQPSSRTFTLLNASGSGVGTLKASK
VAYGTMTDTDLSLYETTSTYQQIEDSYGIQALELETAHPTAGTAITVASGYWKRTYSCDI
DGFVHQLKEGRWTWKDSVRYTPECRTIGGTSGSPVIDDATGKVVAVNNTGNESGQECTDN
NPCEVDENGEVTVREGINYAQQTYTMVPCIGAGSKIDLDREGCALPKP
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcctctcgtcggtgcgtttctcgctgccctgctcctgggggccggcgccgcg
cccgtcgcccaagccgcccccgcgccgcagccgcagacccgggaagccgcgccccaggcc
gatcccgccgcgaaggccgtgaccttcgccgggaccgtcgcgctcagcaactgctccggc
tccgtcgtccgttcgcccgacgccgcccccaccgaccccgccctcgtgctctccaacggg
cactgcctggagtccggcttcccggggcccggtgaggtcgtcgtcgaccagccgtcctcc
cgcacgttcaccctgctcaacgcctcgggcagcggtgtcggcaccctgaaggcgagcaag
gtcgcgtacggcaccatgaccgacaccgacctctcgctctacgagaccacctccacctac
cagcagatcgaggacagctacggcatccaggcgctggagctggagaccgcccacccgacg
gcgggcaccgccatcacggtcgcctccggctactggaagcgcacctacagctgtgacatc
gacggcttcgtccaccagctcaaggagggccggtggacctggaaggactccgtccgctac
accccggagtgccggaccatcggcggcacgtccggctcgccggtgatcgacgacgccacc
ggcaaggtggtcgccgtcaacaacaccggtaacgagagcggccaggagtgcacggacaac
aacccgtgcgaggtcgacgagaacggcgaggtcaccgtccgcgaaggcatcaactacgcc
cagcagacgtacaccatggtcccgtgcatcggagccggcagcaagatcgacctcgaccgt
gagggctgcgcgctgcccaagccgtaa

DBGET integrated database retrieval system