KEGG   Streptomyces griseus: SGR_2553Help
Entry
SGR_2553          CDS       T00691                                 

Gene name
natA
Definition
(GenBank) arylamine N-acetyltransferase
  KO
K00675  N-hydroxyarylamine O-acetyltransferase [EC:2.3.1.118]
Organism
sgr  Streptomyces griseus
Brite
Enzymes [BR:sgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.118  N-hydroxyarylamine O-acetyltransferase
     SGR_2553 (natA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2 Transglut_core
Motif
Other DBs
NCBI-ProteinID: BAG19382
Kitasato: SGR2553
UniProt: B1W2L8
Position
3012291..3013103
Genome map
AA seq 270 aa AA seqDB search
MTLDLDAYFARIGWTGNPRPTLEVLRSLHRAHLIGIPFENLEPVLGSAPSLALDDLEAKL
VHGGRGGYCYEHNTLFSAVLRQIGFSVTPLTARVVLGAAPGDIRPRTHMLMRVDVAGEPH
PYLADVGFGAVGALLEPIELVEDAELSDAPRRHRLVHAPHHGPLPLWELQAGQGGSWEPQ
YDFTLDPYEKPDYEVINWFIATHPRSPFRQAVYAQRTRIGSHLALSGLDLVETADDGTIR
ERRLEDGDEALRVLTDDFGIRLPEGVRLPE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgactctcgacctcgacgcgtacttcgcccgcatcggctggaccggaaatccccgcccc
acgctggaggttttgcggtccctgcaccgcgcccacctgatcggcatcccgttcgagaac
ctggagccggtcctcggctccgccccgtcgctggccctcgacgacctggaggcgaagctc
gtgcacggcgggcgcggcggctactgctacgagcacaacaccctgttctccgccgtgctg
cggcagatcggcttctccgtgacaccgctgacggcccgggtggtgctgggcgccgcgccg
ggcgacatccggccccgtacgcacatgctcatgcgggtggacgtggcgggcgagccgcac
ccgtacctggcggacgtcgggttcggggcggtgggcgccctgctggagccgatcgagctg
gtggaggacgccgaactgtccgacgcgccgcgccgccaccggctggtccacgcaccgcac
cacggtccgctgcccctgtgggagctccaggccggccagggcgggtcctgggagccgcag
tacgacttcacgctggacccgtacgagaagccggactacgaggtgatcaactggttcatc
gcgacgcacccgcgctcaccgttccggcaggcggtgtacgcgcagcgcacccggatcggc
tcccacctggcgctgtcggggctcgacctggtggagacggccgacgacggcacgatccgg
gagcggcggctggaggacggggacgaggcgctgcgcgtcctgacggacgacttcggcatc
cggctccctgagggcgtccggctgccggagtga

DBGET integrated database retrieval system