KEGG   Streptomyces griseus: SGR_2556Help
Entry
SGR_2556          CDS       T00691                                 

Definition
(GenBank) putative phosphoenolpyruvate carboxykinase
  KO
K01596  
phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
sgr  Streptomyces griseus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGR_2556
   00020 Citrate cycle (TCA cycle)
    SGR_2556
   00620 Pyruvate metabolism
    SGR_2556
Enzymes [BR:sgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     SGR_2556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3015583..3017409)
Genome map
AA seq 608 aa AA seqDB search
MARDIAAPLTVPTHHQELVSWVDEIAAITQPDRVVWCDGSEAEYERLCGELVAKGTFTKL
DEIKRPNSYYAASDPSDVARVEDRTFICSKEEKDAGPTNHWKDPAEMREIFTGGNGVFRG
SMRGRTMYVVPFCMGPLGSPLSAIGVEITDSAYVAVSMRTMTRMGRAVLDELGTDGFFVK
AVHTLGAPLEEGQKDVPWPCNTTKYISHFPEDREIWSYGSGYGGNALLGKKCYALRIASV
MARDEGWLAEHMLILKLTPPRGESKYVAAAFPSACGKTNLAMLEPTIPGWTVETIGDDIA
WMRFGEDGRLYAINPEAGFFGVAPGTGEHTNANAMKTMWGNSVFTNVALTDDGDVWWEGM
TEEAPAHLTDWKGNDWTPESGTPAAHPNARFTVPAGQCPTIAPEWEDPKGVPISAILFGG
RRASAVPLVTESFDWQHGVFLGANVASEKTAAAEGKVGELRRDPFAMLPFCGYNMGDYMN
HWVKVGADKADQSKLPKIYYVNWFRKNDAGKFVWPGFGENSRVLKWIVERLEGTGEGVES
PIGILPAKGALDTEGLDLSEADLDFLLTVDKKVWREEAALVPEHLNTFGDHTPKELWDEY
HALVERLG
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgcgacatcgcggctcccctcactgtccccacccaccaccaggagctggtctcc
tgggtcgacgagatcgcagccatcacccagccggaccgggtggtctggtgcgacggttcc
gaggccgagtacgagcgcctgtgcggggagctcgtggccaagggcacgttcaccaagctg
gacgagatcaagcggccgaactcgtactacgccgcgtccgacccgagcgacgtcgcccgc
gtcgaggaccgtacgttcatctgctccaaggaggagaaggacgccggccccacgaaccac
tggaaggaccccgccgagatgcgggagatcttcaccggcgggaacggtgtcttccgtggg
tccatgcgcggtcggaccatgtacgtcgtgcccttctgcatggggcccctcggctcgccg
ctctccgcgatcggcgtcgagatcaccgactccgcgtatgtcgccgtctccatgcgcacc
atgacccgcatgggccgggccgtcctggacgagctgggcaccgacggcttcttcgtgaag
gccgtccacaccctgggcgctcccctggaggagggccagaaggacgtcccgtggccctgc
aacaccaccaagtacatctcgcacttccccgaggaccgcgagatctggtcgtacggctcc
ggctacggcggcaacgccctgctcggcaagaagtgctacgccctgcgcatcgcctccgtc
atggcccgcgacgagggctggctcgccgagcacatgctcatcctgaagctcacgccgccg
cgcggtgagtcgaagtacgtcgctgccgcgttcccctcggcctgcggcaagaccaacctc
gccatgctggagccgaccattcccggctggaccgtggagaccatcggcgacgacatcgcc
tggatgcggttcggcgaggacggccgcctctacgccatcaacccggaggccggcttcttc
ggcgtcgcgcccggcaccggcgagcacaccaacgccaacgccatgaagaccatgtggggc
aactccgtcttcaccaacgtcgcgctcaccgacgacggcgacgtgtggtgggagggcatg
accgaggaggcgcccgcgcacctcacggactggaagggcaacgactggacccccgagtcc
ggcacccccgccgcccaccccaacgcccgcttcaccgtccccgccggacagtgcccgacc
atcgcgcccgagtgggaggaccccaagggcgtgccgatctccgcgatcctcttcggcggc
cgtcgcgcctccgccgtcccgctggtcaccgagtccttcgactggcagcacggtgtcttc
ctcggcgccaacgtcgcctccgagaagaccgccgccgccgagggcaaggtcggcgagctg
cgccgcgacccgttcgccatgctgccgttctgcggctacaacatgggcgactacatgaac
cactgggtcaaggtcggcgccgacaaggccgaccagtcgaagctcccgaagatctactac
gtcaactggttccgcaagaacgacgcgggcaagttcgtctggcccggcttcggcgagaac
agccgtgtcctgaagtggatcgtggagcgcctggagggcacgggcgagggcgtcgagtcc
ccgatcggcatcctgccggccaagggcgcgctcgacaccgagggcctggacctctccgag
gccgacctcgacttcctcctcacggtcgacaagaaggtctggcgcgaggaggccgccctg
gtccccgagcacctgaacaccttcggcgaccacacgcccaaggagctgtgggacgagtac
cacgcgctcgtcgagcgcctgggctga

DBGET integrated database retrieval system