KEGG   Streptomyces griseus: SGR_2558Help
Entry
SGR_2558          CDS       T00691                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06888  
uncharacterized protein
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3018394..3020412)
Genome map
AA seq 672 aa AA seqDB search
MNRLADETSPYLLQHADNPVDWWPWSPEAFAEARERGVPVLLSVGYSSCHWCHVMAHESF
EDETVATYLNAHFVPVKVDREERPDIDAVYMEAVQAATGHGGWPMTVFLTPDAEPFYFGT
YFPPEARHGSPSFQQVLEGVVAAWTDRREEVAEVAERIVADLAGRSLVHGGDGVPGESEI
AQALLGLTREYDEQHGGFGGAPKFPPSMVVEFLLRHYARTGSEGALQMAADTCSAMARGG
IYDQLGGGFARYSVDREWVVPHFEKMLYDNALLCRVYAHLWRTTGSDEARRIALETADFM
VRELRTAEGGFASALDADSEDADGRHVEGAYYVWTPAQLREVLGEDDAAFAAAYFGVTEK
GTFEEGASVLRLPGDTGPVDAARVADVRGRLLAAREERPRPGLDDKVVAAWNGLAIAALA
ETGAYFDRPDLVERATEAADLLVRVHLGEVARLARTSKDGQAGDNAGVLEDYGDVAEGFL
TLAAVTGEGAWLEFAGFLLDIVLEQFTGEGGQLYDTAHDAEQLIRRPQDPTDSATPSGWT
AAAGALLSYAAYTGSEAHRTAAEGALGVVKALGPRVPRFVGWGLAVAEALLDGPREVAVA
GPVGGELHRTALLGRAPGAVVAAGEGPGAGAEFPLLVDRPLVGGEPTAYVCRHFVCDAPT
TDAGELAAKLGG
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcgccttgctgatgagacctcgccgtacctgctccagcacgccgacaacccggtc
gactggtggccatggtccccggaggcgttcgcggaggcccgggaacggggggtgccggtg
ctgctgagcgtcggctacagctcctgccactggtgccatgtgatggcccacgagtccttc
gaggacgagaccgtcgccacctacctcaacgcccacttcgtgcccgtgaaggtcgaccgc
gaggagcggcccgacatcgacgccgtctacatggaggccgtccaggcggcgaccgggcac
ggcgggtggccgatgaccgtcttcctcacgccggacgccgaacccttctacttcgggacc
tacttcccgcccgaggcgcggcacggctcgccctccttccagcaggtcctggagggtgtg
gtggccgcctggaccgaccggcgtgaggaggtcgccgaggtggcggagcggatcgtcgcc
gatctggcggggcggtcgctggtccatggcggggacggggtgccgggggagtcggagatc
gcccaggcgctgctcgggctgacccgggagtacgacgagcagcacggcgggttcgggggc
gcgcccaagttcccgccgtccatggtggtggagttcctgctgcggcactacgcccgtacg
gggtcggagggggcgctccagatggccgccgacacctgttcggcgatggccaggggcggg
atctacgaccagctcggcgggggctttgcgcgctactccgtggaccgggagtgggtggtg
ccgcacttcgagaagatgctgtacgacaacgcgctgctctgccgcgtgtacgcccatctg
tggcggaccaccgggtcggacgaggcccggcggatcgccctggagacggccgacttcatg
gtgcgggagctgcggaccgccgagggcggcttcgcctccgcgctggacgcggacagtgag
gacgcggacggcaggcatgtcgagggcgcctactacgtgtggacgcccgcccagctccgt
gaggtgctgggcgaggacgacgccgccttcgccgccgcgtacttcggggtgacggagaag
gggacgttcgaggagggggcgtccgtgctccggctgccgggggacacggggcccgtggac
gccgcccgggtcgcggacgtacggggccggctgctggcggcccgcgaggagcggccgcgc
ccggggctggacgacaaggtggtcgccgcctggaacgggctcgccatcgccgcgctcgcc
gagaccggcgcctacttcgaccggcccgacctcgtggagcgggccacggaggccgccgac
ctgctggtccgggtgcacctgggcgaggtggcccggctggcccgcacctccaaggacggg
caggccggtgacaacgccggggtgctggaggactacggcgatgtcgccgagggcttcctc
acgctggccgcggtgacgggggagggcgcctggctggagttcgccgggttcctgctggac
atcgtgctggagcagttcacgggggagggcggtcagttgtacgacaccgcccatgacgcc
gagcagctcatccggcggccccaggaccccaccgacagcgccaccccgtccgggtggacg
gccgccgccggcgcgctgctctcctacgccgcgtacaccggctccgaggcccatcggacg
gccgccgagggcgcgctcggtgtggtgaaggcgctggggccgcgcgtgccccggttcgtc
ggctgggggctcgcggtggccgaggcgctgctggacgggccccgtgaggtcgccgtcgcc
gggccggtcggcggggagctgcaccgtacggcgctgctggggcgggccccgggtgcggtg
gtcgcggcgggggaggggccgggggcgggggccgagttcccgctgctggtggaccggccg
ctggtgggcggggagccgaccgcgtacgtctgccgccacttcgtctgcgacgcgccgacg
acggatgcgggggagttggcggccaagctgggcgggtga

DBGET integrated database retrieval system