KEGG   Streptomyces griseus: SGR_2562Help
Entry
SGR_2562          CDS       T00691                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K18455  
mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
sgr  Streptomyces griseus
Brite
Enzymes [BR:sgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     SGR_2562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3025781..3026662)
Genome map
AA seq 293 aa AA seqDB search
MTEQLRLMAVHAHPDDESSKGAATMAKYVSEGVDVLVVTCTGGERGSILNPKLQGDAYIE
KNIHEVRKKEMDEAREILGVQQEWLGFVDSGLPEGDPLPPLPEGCFALEDPEAAAGRLVA
KIRAFRPQVITTYDENGGYPHPDHIMTHTISMIAFDGAADAERFPEEEFGPVWTPRKLYY
NQGFNRPRTVALHEALLARGLESPYGDWLARWEEFERVERTLTTHIPCDDFFEIRDKALI
AHATQIDPEGGWFRVPMDIQREVWPTEEYELAKSLVDTSLPESDLFAGIRDNA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgactgagcagctgcgactgatggccgttcacgcccaccccgacgacgagtcgagcaag
ggcgcggccaccatggccaagtacgtgtccgagggggtggacgtgctggtcgtgacctgc
acgggaggcgagcgcggctccatcctcaacccgaagctccagggcgacgcgtacatcgag
aagaacatccacgaggtgcgcaagaaggagatggacgaggcccgggagatcctgggcgtc
cagcaggagtggctcggattcgtcgactcggggctgcccgagggcgacccgctgccgccg
ctgcccgagggctgcttcgccctggaggaccccgaggccgccgcggggcgcctggtggcg
aagatccgcgcgttccggccgcaggtcatcaccacgtacgacgagaacggcggctacccg
caccccgaccacatcatgacgcacacgatctcgatgatcgcgttcgacggtgcggccgac
gcggagcggttccccgaggaggagttcggcccggtctggacgccgcgcaagctctactac
aaccagggcttcaaccggccgcggaccgtcgccctgcacgaggcgctcctcgcccggggc
ctggagtccccgtacggcgactggctggcgcgctgggaggagttcgagcgcgtggaacgc
acgctgaccacgcacatcccctgcgacgacttcttcgagatccgcgacaaggcgctcatc
gcgcacgccacgcagatcgaccccgagggcggctggttccgggtcccgatggacatccag
cgcgaggtgtggcccaccgaggagtacgagctggcgaagtctctggtcgatacctccctc
cccgagagcgacctcttcgcgggcatccgcgacaatgcctga

DBGET integrated database retrieval system