KEGG   Streptomyces griseus: SGR_2564Help
Entry
SGR_2564          CDS       T00691                                 

Definition
(GenBank) putative transcription elongation factor
  KO
K03624  
transcription elongation factor GreA
Organism
sgr  Streptomyces griseus
Brite
Transcription machinery [BR:sgr03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    Transcription elongation factors
     SGR_2564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
3027515..3028012
Genome map
AA seq 165 aa AA seqDB search
MTQTSENVTWLTQEAYNQLKAELEHLSGPARTEIAVKIAAAREEGDLRENGGYHAAKEEQ
GKMELRVRQLTQLLEHAKVGEAPADDGVVEPGMVVTIAFDGDENDTLTFLLASREYASTE
IETYSPQSPLGLGVNGKRTGDDADYELPNGKTASVKILAAKPYTG
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
gtgacccagaccagcgaaaacgtcacctggctcacgcaggaggcgtacaaccagctcaag
gccgagctggagcacctgtctggtcccgcgcgcacggagatcgccgtcaagatcgcggcg
gcccgtgaggagggtgacctccgggagaacggcgggtaccacgcggccaaggaggagcag
ggcaagatggagctgcgggtgcgccagctcacccagctcctggagcacgcgaaggtcggc
gaggcgccggccgacgacggcgtggtcgagcccggcatggtcgtcacgatcgccttcgac
ggcgatgagaacgacacgctgaccttcctgctcgcctcccgtgaatacgccagcacggag
atcgagacgtactccccgcagtccccgctcggcctcggcgtgaacggcaagcggacgggc
gacgacgcggactacgagctgccgaacggcaagacggcgtcggtgaagatcctggcggcg
aagccctacaccggctga

DBGET integrated database retrieval system