KEGG   Streptomyces griseus: SGR_2567Help
Entry
SGR_2567          CDS       T00691                                 

Definition
(GenBank) putative ABC transporter ATP-binding protein
  KO
K01990  
ABC-2 type transport system ATP-binding protein
Organism
sgr  Streptomyces griseus
Module
ABC-2 type transport system
Brite
Transporters [BR:sgr02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    SGR_2567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3029854..3030876)
Genome map
AA seq 340 aa AA seqDB search
MPGAIHAEGLVKTFGDVRALDGVDLDVPEGTVLGLLGPNGAGKTTAVRVLTTLLRPDSGT
AVVAGIDVLKRPNEVRRSIGLSGQFAAVDEYLTGRENLQMVGQLYQLSARDAKARAGVLL
DRFNLGDAADRTAKTYSGGMRRRLDLAAALVVSPPVMFMDEPTTGLDPRNRQQLWDVIED
LVAGGTTLLLTTQYLEEADRLANDICVIDHGRVIARGTSDELKARTGGERVEVVVHRPDE
IEPARSVLTSLGKGEVTVVRLSRKLTAPVSGGAKLLAEIIRDLDARGVEIDDIALRRPTL
DDVFLSLTGHAAEAHENGDEEPGRAPAERSPDPRSKEDTR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtgcgatccacgccgaaggtctggtgaagacgttcggcgacgtacgagccctc
gacggcgtcgacctcgacgtccccgaaggcacggtcctcgggctgctcgggcccaacggc
gcgggcaagaccaccgccgtacgcgtgctgaccacgctgctgcgcccggacagcggtacg
gcggtcgtggccgggatcgacgtcctgaagaggccgaacgaggtacgccgctcgatcggg
ctctccggacagttcgccgcggtcgacgagtatctgaccggccgggagaacctccagatg
gtcggacagctctaccagctgagcgcccgggacgcgaaggcccgggcgggcgtcctgctg
gaccggttcaacctcggcgacgccgccgaccgcaccgccaagacgtactccggaggcatg
cgccgtcgcctcgacctcgcggcggcgctcgtcgtgtcgccgcccgtgatgttcatggac
gagccgacgaccggcctcgacccgcgcaaccggcagcagctctgggacgtgatcgaggac
ctggtggcgggcggcacgacgctgctgctgaccacgcagtacctggaggaggccgaccgc
ctcgcgaacgacatctgcgtcatcgaccacggcagggtcatcgcccgcggcacctccgac
gagctcaaggcccgcaccggcggcgagcgcgtcgaggtcgtcgtgcaccgccccgacgag
atcgagcccgcccggtcggtcctgacctcactcggcaagggcgaggtcaccgtcgtccgg
ctctcccgcaagctcaccgccccggtcagcggcggggccaagctgctggccgagatcatc
cgcgacctggacgcccggggcgtggagatcgacgacatcgccctgcgcaggcccaccctg
gacgacgtcttcctctccctcaccggccacgcggccgaggcgcacgagaacggcgacgag
gagcccggcagggccccggcggaacgttcccccgacccccggagcaaggaggacacccgg
tga

DBGET integrated database retrieval system