KEGG   Streptomyces griseus: SGR_2569Help
Entry
SGR_2569          CDS       T00691                                 

Definition
(GenBank) putative MarR-family transcriptional regulator
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
3032413..3032943
Genome map
AA seq 176 aa AA seqDB search
MPPQDMTTAASPSGGAVPEHPGPDRLLDSLQHQVAVFARRAEQTRLGGVGQVRNSMDRAA
YLLLNRLDREGPMGVKALAAGMGIDSSTVTRQVAPLVDTGLVKRTSHPEDGRAVVLQLSP
RGQARLEEVRASRRELMSQVTDGWTQEERDTFCALLTRFNGSLAARQAAYQPPQPD
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgccccctcaggacatgacgactgctgcgtctccttccgggggcgccgtccccgaacac
ccgggccccgaccgcctgctggactccctccagcaccaggtggcggtcttcgcccgccgt
gccgagcagacccgcctcggcggtgtcggccaggtccgcaactcgatggaccgggcggcc
tatctgctgttgaaccggctggaccgggagggcccgatgggcgtcaaggcgctggcggcc
gggatgggcatcgactcctcgacggtgacgcggcaggtcgcgccgctcgtcgacaccggt
ctggtgaagcgcacgtcgcacccggaggacggccgggccgtggtgctccagctctcgccg
cgcggtcaggcccggctggaggaggtccgcgcctcgcggcgtgagctgatgtcccaggtg
acggacggctggacgcaggaggaacgggacacgttctgcgccctgctcacccgcttcaac
gggtcgttggccgcccggcaggccgcgtaccagccgccgcagcccgactga

DBGET integrated database retrieval system