KEGG   Streptomyces griseus: SGR_2570Help
Entry
SGR_2570          CDS       T00691                                 

Definition
(GenBank) putative anti-anti-sigma regulatory factor
  KO
K17763  rsbT co-antagonist protein RsbR
Organism
sgr  Streptomyces griseus
Brite
Transcription machinery [BR:sgr03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     SGR_2570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RsbRD_N STAS STAS_2 RVP Nup96
Motif
Other DBs
NCBI-ProteinID: BAG19399
Kitasato: SGR2570
UniProt: B1W2N5
Position
3033080..3033931
Genome map
AA seq 283 aa AA seqDB search
MAKQVSPRGPVELLTTDREKVTADWIDTVAGSLQGRISRAEVDRELRELYGALVEGLREG
GDDTRGESLSEARALLTELSRNRARQGFTPSETAISVLALKQALEPALRNDSADDTTAYL
RLARVLDDLALFTVEAYTRTREEIISSQAAQLMELSTPVVKLWNGVIAVPLVGTLDSART
QVVMEKLLQALVDTGSEQAIIDITGVPAVDTQVAQHLLKTVVAARLMGAECTVSGIRPQI
AQTIVALGIEFGDIITKATLADALQHALRASGVDLVAHQGVGR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaagcaggttagtccgagaggtccggtggagctgctgaccaccgaccgggagaag
gtcaccgccgactggatcgacacggtggccgggtcgctccagggccgcatcagcagggcc
gaggtcgaccgggagctgcgcgaactctacggggcgctcgtggaggggctgcgggagggg
ggcgacgacacccgcggcgagagcctctccgaggcgcgggcgctgctcaccgagctgtcg
cgcaaccgggcccggcagggcttcacgcccagtgagaccgcgatcagcgtgctggcgctg
aagcaggcgctggagcccgcgctgcggaacgactccgccgacgacaccaccgcctacctg
cggctggcccgcgtcctcgacgacctggccctgttcaccgtcgaggcgtacacccgcacc
cgcgaggagatcatcagctcgcaggcggcccagctcatggagctgtcgacgcccgtggtc
aagctctggaacggggtcatcgccgtgcccctcgtgggcaccctggactcggcgcgtacc
caggtcgtgatggagaagctgctccaggccctggtggacaccggctccgagcaggccatc
atcgacatcaccggggtgccggccgtcgacacgcaggtcgcgcagcacctgctcaagacg
gtcgtggcggcccggctgatgggcgcggagtgcacggtctccggcatccgcccgcagatc
gcccagaccatcgtggcgctgggcatcgagttcggcgacatcatcaccaaggcgacgctc
gccgacgccctccagcacgcgctgcgcgcgtccggtgtcgacctcgtcgcgcaccagggc
gtcggccgatga

DBGET integrated database retrieval system