KEGG   Streptomyces griseus: SGR_2573Help
Entry
SGR_2573          CDS       T00691                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoIIE HATPase_c_2 HATPase_c
Motif
Other DBs
NCBI-ProteinID: BAG19402
Kitasato: SGR2573
UniProt: B1W2N8
Position
3034709..3035818
Genome map
AA seq 369 aa AA seqDB search
MGAMTGLPVVDCEDVAWFRDGAEMPSAARGAAATLARRIGLDGYRSSEVALAVSEAATNL
QRHANDGALLLRVLRTPDRAGVEFLTIDGGPGIPDVGAALSDGVSSAGTLGIGLGAVARL
ADAFDIHSLPGRGTVVAAQFWARGAGAGPTGGAPSVASGLTRPISGETSCGDAWAVRVDD
GGQEDPRSAASARGGSRSAPSPEPAVLVVLCDGLGHGPLAALASEAAVAAFRRSTARHPE
GLLRDIHAALRGTRGGAVAVARIEPARGRVLYCGIGNVSGILLGPGSRNGLLSAPGIVGQ
QMRGLRTFELPWKPGGALVMHSDGLTERWKADDLPGLLRHTPAVLAGQLLREAGVRRDDA
GIVVVKEAW
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgcgatgaccgggctgcccgtcgtcgactgcgaggacgtggcctggttccgggac
ggcgcggagatgccctcggcggcgcggggcgcggccgccaccctggcccggcgcatcggg
ctggacggctaccggtcctccgaggtcgccctcgcggtcagcgaggccgcgaccaacctc
caacggcacgcgaacgacggcgctctgctgctgcgggtcctgcgcaccccggaccgggcc
ggcgtcgagttcctcaccatcgacggcggcccgggcatccccgacgtcggggcggccctg
tcggacggggtttcctcggcggggaccctcggcatcgggctgggggcggtggcccggctc
gccgacgccttcgacatccactccctgccgggccggggcaccgtcgtggccgcccagttc
tgggcgcgcggggccggtgcgggccccaccggcggggctccgtcggtcgcctcggggctg
acccggcccatcagcggggagacgagctgcggcgacgcctgggccgtacgcgtggacgac
ggcgggcaggaggacccgcggtcggccgcctccgcccgcgggggctcccgctcggcaccg
tccccggagccggcggtcctggtcgtgctgtgcgacgggctgggccacgggccgctcgcc
gcgctcgcctccgaggccgcggtggcggcgttccgccggagcaccgcacgccaccccgag
ggcctgctgcgggacatccacgccgcgctgcggggcacccggggcggcgccgtcgccgtc
gccaggatcgagccggccagggggcgcgtgctctactgcggcatcggcaacgtgagcggg
atcctgctggggcccggctcccgcaacggcctgctctcggcaccgggcatcgtcgggcag
cagatgcgcggcctgcggacgttcgagctgccgtggaagccgggcggggccctcgtcatg
cactccgacgggctgaccgaacggtggaaggccgacgacctgccggggctgctccggcac
accccggcggtgctggccgggcagctgctgcgcgaggccggggtccgccgcgacgacgcc
gggatcgtggtcgtcaaggaggcctggtga

DBGET integrated database retrieval system