KEGG   Streptomyces griseus: SGR_2581Help
Entry
SGR_2581          CDS       T00691                                 

Definition
(GenBank) putative permease of the major facilitator superfamily
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_4
Motif
Other DBs
NCBI-ProteinID: BAG19410
Kitasato: SGR2581
UniProt: B1W2P6
Position
complement(3042350..3043567)
Genome map
AA seq 405 aa AA seqDB search
MAGDMTQLQESSGARAARPEPARHGWPGVAALTLGTFTVVTSEMLPVGLLTPMGRSLGVP
EGVAGLTLTITGLVAALSAPALVPLLGRADRRTALCALVAVLVAGNLGAAWAPGFGTMVA
ARVLVGIGMGGVWAVAAGLAVRLVPAKSAGAATTLVFGGIGLASVLGVPAGTYLGAVAGW
RAAFLAAAGLGLVVLVAAALLLPRLPAERAVPLGGVLRLTRDPRLRTGLLVAGFLVTGHF
AAYTYVRPVLEDVTGVGAGAIGALLLVYGIAGVAGNFLAGAGAARSPRTTLLVIGTVLAL
TVAALPWLGGSPALAAVLMAAWGLGYGGVSVATQTWVLLAVPDAREAASSLFVAVFNGAI
ALGALAGGLVADGIGVTAVMATGAALVAGALVTTAAGRAPAPAGP
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
ttggctggggacatgacgcagcttcaggaatcctcaggggcccgggccgcccgcccggag
cccgcccgccacggctggccgggcgtggccgccctcacgctcggcacgttcacggtggtc
acgtccgagatgctgcccgtcgggctgctcacgccgatgggccgctcgctcggcgtgccg
gagggcgtggccggtctgacgctgaccatcaccggcctcgtcgcggcgctctcggccccg
gccctcgtcccgctgctgggccgggccgaccggcggacggccctgtgcgcgctggtcgcg
gtcctggtcgccggcaacctcggcgcggcctgggcgcccggcttcgggaccatggtcgcc
gcccgcgtcctggtcggcatcggcatgggcggcgtctgggccgtcgcggccgggctcgcg
gtgcgcctcgtcccggcgaagtccgccggcgccgccaccaccctggtcttcggcggcatc
ggcctcgcgtccgtcctgggcgtccccgccggaacgtacctcggcgccgtcgcgggctgg
cgcgccgcgttcctggccgccgccgggctcggcctggtggtgctggtcgcggcggctctc
ctgctgccccggctgcccgccgagcgcgccgttccgctcggcggcgtactgcggctgacc
cgcgacccccggctgcgcaccggtctcctcgtcgccggcttcctcgtcaccgggcacttc
gccgcgtacacctacgtcaggccggtcctggaggacgtcaccggcgtcggtgcgggcgcc
atcggagcgctgctcctggtgtacggaatcgccggcgtcgccgggaacttcctcgccggg
gccggggccgcccggtcaccgcgcacgacgctgctggtgatcggcacggtcctggcgctc
accgtggccgccctgccgtggctcggcggctccccggccctcgcggccgtactgatggcg
gcctggggccttggctacggcggtgtctcggtggccacccagacctgggtgctgctcgcc
gtccccgacgcccgcgaggccgcctcctcgttgttcgtcgcggtgttcaacggcgccatc
gcgctcggggcgctggccggcgggctcgtcgcggacggcatcggcgtcacggcggtcatg
gcgacgggcgccgcgctcgtcgccggtgcgctggtgaccaccgcggccggccgggccccc
gcaccggccgggccgtga

DBGET integrated database retrieval system