KEGG   Streptomyces griseus: SGR_2582Help
Entry
SGR_2582          CDS       T00691                                 

Definition
(GenBank) putative LysR-family transcriptional regulator
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
3043659..3044567
Genome map
AA seq 302 aa AA seqDB search
MSNPEIRELEAFLALAEELHFGRAGERLYLSQSRISQLLRALESRIGGRLVDRTSRRVRL
TPLGEQLHVGLRPAFDAIVATIDAVRDTARGLGGVLRVGFQGTANDLFLRAVTAFRDGHP
DCAAEIVEIPLSDPFGAVHRGEVDAAVVLMPVLDDALVLGPVFSARPLTLAVSARHPYAR
RPAVDAEELASGPLIGIAGAAPEYWRLVQAPAVTPGGRAIPAGPAVSSLQEGLALVRAGR
GAMLLCDPTADYYGSHAVAFVPVTGLPESSLALVWHRNHETARIRGFARALADVTGDAGA
AG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccctgagatccgggagctggaggcgttcctcgccctggccgaggagctgcac
ttcggccgggccggagagcgcctctacctctcgcagagccggatcagccagctgctgcgg
gcgctggagagcagaatcggcggccggctggtcgaccgcacgagccgccgggtccggctc
accccgctcggcgaacagctgcacgtcgggctgcggccggccttcgacgcgatcgtcgcg
acgatcgacgcggtgcgggacacggcgcggggtctggggggcgttctccgggtcggcttc
cagggcacggcgaacgacctgttcctgcgggcggtgacggccttccgggacgggcatccg
gactgtgccgccgagatcgtggagatcccgctctccgacccgttcggcgcggtgcaccgc
ggggaggtggacgcggcggtggtgctgatgccggtcctggacgacgcgctggtgctcggc
ccggtcttctccgcccggccgctgaccctcgcggtgtccgcccggcacccgtacgcgcgc
cggcccgccgtcgacgccgaggagctggcgagcggcccgctcatcggcatcgccggggcg
gccccggagtactggcggctggtccaggccccggccgtcacgcccggcggccgggcgatt
ccggccggtcccgcggtgagcagcctccaggaggggctggccctggtacgggccggccgg
ggggcgatgctgctgtgcgacccgacggccgactactacggcagccacgcggtggccttc
gtcccggtgaccggcctccccgagtcctccctggcgctggtgtggcaccggaaccacgag
acggcccggatccgcggtttcgcccgggcgctggcggacgtcaccggggatgccggtgcc
gccgggtga

DBGET integrated database retrieval system