KEGG   Streptomyces griseus: SGR_2583Help
Entry
SGR_2583          CDS       T00691                                 

Definition
(GenBank) putative peptide methionine sulfoxide reductase
  KO
K07304  
peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11]
Organism
sgr  Streptomyces griseus
Brite
Enzymes [BR:sgr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.11  peptide-methionine (S)-S-oxide reductase
     SGR_2583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
3044664..3045332
Genome map
AA seq 222 aa AA seqDB search
MFLNHRTPVLPTPEQALRGRPVPEFTVPSRHTVLGNPLVGPYPDGLEVADFALGCFWGAE
RKFWQTEGVWTTLVGYQGGYTENPSYEEACSGLTGHTEAVRVVFDPAVVSYEELLKLFWE
SHNPTQGFRQGNDVGTQYRSAIYTHSPAQAAAADASRAAYQKVLTASGHQEITTEILPAE
GRPFWPAEAYHQQYLDKNPGGYCGIGGTGVSCPIGVAPADGR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaccaccgcacccccgtgctccccaccccggagcaggccctgcgcggccgc
cccgtccccgaattcaccgtcccctcccgccacacggtcctcggcaacccgctggtgggc
ccgtatccggacggcctggaggtggcggacttcgcgctgggctgtttctggggcgcggag
cggaagttctggcagaccgagggcgtctggacgacgctcgtcggctaccagggcggctac
acggagaacccctcgtacgaggaggcctgctcgggcctgaccgggcacacggaggcggta
cgcgtcgtcttcgacccggcggtcgtctcgtacgaggagctgctgaagctgttctgggag
tcccacaacccgacccagggcttccgccagggcaacgacgtgggcacccagtaccgctcc
gcgatctacacccactcccccgcccaggcggcagcggccgacgcctcccgtgcggcgtac
cagaaggtcctgacggcctcgggccaccaggagatcaccacggagatcctcccggccgag
ggccgcccgttctggccggcggaggcgtaccaccagcagtacctggacaagaaccccggc
ggctactgcggcatcggcgggacgggcgtctcctgcccgatcggcgtcgcccccgccgac
gggcgctga

DBGET integrated database retrieval system