KEGG   Streptomyces griseus: SGR_2587Help
Entry
SGR_2587          CDS       T00691                                 

Definition
(GenBank) putative thioesterase
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioesterase Abhydrolase_6 Hydrolase_4 LIDHydrolase
Motif
Other DBs
NCBI-ProteinID: BAG19416
Kitasato: SGR2587
UniProt: B1W2Q2
Position
complement(3048501..3049340)
Genome map
AA seq 279 aa AA seqDB search
MTTMTWSPRRTADTTAHRAAPATAWFPPERSPAGPFRRRLYCLPHAGGSSSAYRTWAGRL
GDDTEVVPVQLPGRGTRFAERLATTAEEIADGLAAAIAEREDGEWSLFGHSMGALLAYEV
AHRMSASGRPPAHLVVSGMTAPPLAARRDRRPVRELSDAELMRRIGELGATPEDVLRSTE
MMELLLPVFRADYQVCDSYRFTSRPPLRVPVTVLGGAADPGAPVAGLSAWRDLTSAAYAL
RLFPGGHFYLNDRLDQVLRSVRAACEGGGHPLGGRPHHV
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgatgacctggtctcctcggcggacggccgacaccaccgcgcaccgggcggcc
cccgccaccgcctggtttcccccggagcggagtcccgcgggcccgttccgccggcgtctc
tactgtctgccgcacgccgggggcagttcctccgcctaccggacgtgggccgggcggctc
ggcgacgacaccgaggtcgtaccggtgcaactgccgggccggggaacccggttcgccgag
cggctcgccaccaccgccgaggagatcgcggacggcctcgccgccgccatcgccgaacgc
gaggacggggagtggagcctgttcggccacagcatgggcgctctcctcgcctacgaggtg
gcccaccgcatgtccgcctccggccggccgcccgcccacctcgtcgtctccggcatgacc
gcgccgcccctggcggcccgccgcgaccgccgtccggtacgggagctgtcggacgccgaa
ctgatgcggcggatcggggagctcggcgccacgcccgaggacgtgctgcgctcgacggag
atgatggagctgctgctgcccgtcttccgggccgactaccaggtctgcgacagctaccgg
ttcacctcgcggcccccgctgcgggtcccggtcaccgtcctcggcggcgccgccgacccc
ggagcgccggtcgccggcctttcggcctggcgggacctgacgtccgccgcgtacgcgttg
cgtctcttccccggcgggcacttctacctgaacgaccgtctcgaccaggtgctccggtcc
gtccgggcggcctgcgagggcggcggccatcccctcgggggccggccgcaccacgtctag

DBGET integrated database retrieval system