KEGG   Streptomyces griseus: SGR_2588Help
Entry
SGR_2588          CDS       T00691                                 

Definition
(GenBank) putative NRPS
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAG19417
Kitasato: SGR2588
UniProt: B1W2Q3
Position
complement(3049350..3059129)
Genome map
AA seq 3259 aa AA seqDB search
MPASPSQLGLWLQGELEPGSSAYNVPVAMRLTGPLDAAAVDDAVTLLGVRHEILRTTFGL
SDGEVSQFIHPEPAWRMEHVALDHLTPEAAEAACREDSGARAAAPFDLTEGPLLRPVLYR
LAEQDHVLLLAMHHIVTDGWSMGVVMTELRALYAERNPDALPARALQYADFAVWHRDWLA
GGVSEQQLEHWRADLADELVLDLPTDHPRPAVPTHRGERITAVLSERVTQQLRELAASQR
TGLFAAFQAAFAATLSRYSGQHEIRIGVPTAGRHHPHTEELIGYFANTLVVRTEVDRSQG
FRTLLGQVRGRLATALGHADVPFRDVVRALGQGQDRTGQPLFRAMVSEENMPEAFDLAPG
LRADRFDIPNPTAKFDLTLFVADSPGGARLTLEYSTELFTGQTAERLLDAVLALSRNAVN
HPDRALCTLTAVSVEDQVRLSRWSRGADAVDGGATALDLFHARAADAAGTVAVVVGTTRV
TYAELDHRAGRVAAALLAAGVRPGQVVGVLLPRSVDLVAAMLGAWKCGAAFLALDTGQPA
ERLAALVRDSSAAVVVGTGERARDVAGTTRLVDVTDLPEHPAPGTTGAGAAAYVLYTSGS
TGRPKGVVVPHQGLANYLRWAVDAYGAGRTPVAPVHSSVAFDLTVTSLWVPLIAGGTIHL
VDEADPLDGLVAVVSGPVRPNLIKLTPSHLQALCRLIPEGGLAGLDACFVVGGEALSPVL
VDQFRAVAPDATVVNEYGPTETVVGCCVHTLAPGEAVPERPGIPAGRPIAGTSLYVLDER
MAPVPVGVPGELYIGGTQVAWGYLGDGAKTAAVFVPDPFSSVRGARLYRTGDLVRYLPTG
ELEFLGRRDHQVKIRGQRIELGEVENALRGLPGITDAVVIARPDTTGGTALVGYATGSVD
PADARTALARTLPEAMIPATVVVLAEIPLTPNGKVDRAALPAPDLSVARVGYRAPVTGEE
CRLAELFAEVLGVERVGLDDDFFTLGGHSLLATQLIARIRSDFGVQLPLRTLFESPVLGV
LAGVVVSAGRVGALPELVRVDRGGELPLSFAQQRMWFLHELDPEGSFYNVPAAVRLSGGL
DVGRLRGALMVVAGRHEVLRTRFVEGVAGPVQVVGDEPAIEFVVRDVSGVGDPDAVALGA
ARDLAGLPFDLVAGPLMRVVVMRVREGEHVLALSMHHIVSDGWSVGVLLREIQAAYAGRE
LPDLVVQYADYAAWQRSWLTGDVLEEQLAYWRHELAGAPSALDLPTDRPRPATPSHRGAQ
LTEALDAMTVSRLAEAAQVRGTTLFSVLQSVLAAVLSRRSGQGDVVIGVPVANRSRVETE
DLIGFFVNTLPLRTRVAAGDSFEELLDQVSRTALEGLSHQDVPFDRLVQELAPDRDRSRN
PIFQVMLAFQNAPTGEAAPGDLDLTYLPVGDGTAKFDLMLLVEEAAGGELSLALEYSTDL
FTEQTARAVLDDIQRACRAAAADPACPVGELAPVSEKESEILAGWNRTDRADRLDSLVAR
VREHASIRPGAVALTDDHGSLTYRELVGRASRVSRELLAAGVVADDRVAFHGERGADAVV
AFLGILGAGGAYLPLDPNAPLARKADMVTASGARLLITTAGHTAPTHAIATEAGTHPDVL
VCPTAADAPEELVPLRALDGDDLAYVLYTSGSTGRPKGAMVHHAGMNNHLLAKVDDLGLT
GGDVIAQNAALTFDISVWQMTAALVTGGRTAVYGDETAHHATELFLRADRDAVTVLEVVP
SLLRAALDAWDTVEESAPALPVLRKLVVTGEALPPDLCTRWFARYPGIDVVNAYGPTECS
DDVTHATLTPGTETRHAHIPIGSAVRNTRLYVLDEDLRPLPVGVRGELFVAGTGVGRGYL
DDPARTAAAFIPDPFSTTPGARLYATGDIARHLPTGELEFLGRRDHQVKIRGQRIELGEV
ENALRDLPGITDAVVIAHTDPNNQTRLAAYTTGPLLPAQTRTALATTLPETLIPTHITTL
DTMPLTPNGKVDRAALPAPDLSVARVGYRAPVTGEECRLAELFAEVLGVERVGLDDDFFT
LGGHSLLATQLIARIRSDFGVQLPLRTLFESPVLGVLAGVVVSAGRVGALPELVRVDRGG
ELPLSFAQQRMWFLHELDPEGSFYNVPAAVRLSGGLDVGRLRGALMVVAGRHEVLRTRFV
EGVAGPVQVVGDEPAIEFVVRDVSGAGDPDAVALGAARDLAGLPFDLVAGPLMRVVVMRV
REGEHVLALSMHHIVSDGWSVGVLLREIQAAYAGRELPDLVVQYADYAAWQRSWLTGDVL
EEQLAYWRHELAGAPSALDLPTDRPRPATPSHRGAQLTEALDTPTVTRLTEAAQQRGTTL
FSVLQSVLAAVLSRRSGQGDVVIGVPVANRSRVETEDLIGFFVNTLPLRTRVAAGDSFEE
LLDQVSRTALEGLSHQDVPFDRLVQELAPDRDRSRNPIFQVMLAFQNAPTTQTAPGDLDL
TYLPVGDTTAKFDLMLLAEETSGGELALVLEYSTDLFTEQTARAVLDDIQRACRAAAADP
ACPVGELAPVSQREDDLLRTWNRTDRSDRLDSLVARVREHASIRPGAVALTDDHGSLTYR
ELVGRASRVSRELLAASVVADDRVAFHGERGADAVVAFLGILGAGGAYLPLDPNAPLARK
ADMVTASGARLLITTAGQTEQTHAIATEAGRTAGTGTVTSEAGTPPTVLVCPTAADAPEE
LVPDRITHGDDLAYVLYTSGSTGRPKGAMVHHAGMNNHLLAKVDDLGLTGGDVIAQNAAL
TFDISVWQMTAALVTGGRTAVYGDETAHHATELFLRADRDAVTVLEVVPSLLRAALDAWD
TVEESAPALPVLRKLVVTGEALPPDLCTRWFARYPGIDVVNAYGPTECSDDVTHATLTPG
TETRHAHIPIGSAVRNTRLYVLDEDLRPLPVGVRGELFVAGTGVGRGYLDDPARTAAAFI
PDPFSTTPGARLYATGDIARHLPTGELEFLGRRDHQVKIRGQRIELGEVENALRDLPGIT
DAVVIAHTDPNNQTRLAAYTTGPLLPAQTRTALATTLPETLIPTHITTLDTMPLTPNGKI
DRAALPTPDLTFERTPYRAPGTLEERLLAELFAEVLGVEEVGLDDDFFTLGGHSLLATQL
IARIRSDFGVQLPLRTLFETPALEPLAAEVTALIAEGAHDGGHTAGVETLLAEIEHLSDE
EVEALLSGSAASAAGPAQVASAAGPAQVAPAAGPAQVAPAARPVQVQPAAGPAPAAGPVP
GRPAPGADAHRPTHASTRL
NT seq 9780 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcctctccgagccagctcggcctgtggctgcagggcgagctggaacccgggtcg
agcgcctacaacgtgcccgtggccatgcgcctcaccggccccctggacgctgccgccgtc
gacgacgccgtaacgctgctcggtgtgcggcacgagatcctccgcaccaccttcgggctg
tcggacggggaggtgtcccagttcatccaccccgagccggcctggcgcatggaacacgtc
gccctggaccacctcacgcccgaggccgccgaggcggcgtgccgcgaggacagcggcgcg
cgggccgccgcacccttcgacctcaccgagggaccgctgctgcgaccggtgctctaccgg
ctcgccgagcaggaccacgtgctgctcctcgccatgcaccacatcgtcaccgacggctgg
tccatgggcgtcgtcatgaccgaactgcgcgccctgtacgccgagcggaaccccgacgcg
ctgcccgcccgcgcgctgcagtacgccgacttcgcggtctggcaccgggactggctggcc
ggcggcgtcagcgaacagcagctggagcactggcgtgccgacctcgccgacgagctcgtc
ctcgacctgcccaccgaccacccgcggcccgcggtccccacgcaccgcggcgaacggatc
accgcggtgctctccgagcgggtcacccagcagctccgggaactggccgcctcccagcgc
acaggcctgttcgccgcgttccaggccgcgttcgccgccaccctctcccggtacagcgga
cagcacgagatccggatcggcgtgcccacggcgggccgccaccacccgcacaccgaggaa
ctgatcggctacttcgccaacaccctcgtcgtccggaccgaggtcgaccggagccagggg
ttccgcaccctgctcggccaggtgcgcggccggctcgccacggcgctcggccacgccgac
gtcccgttccgcgacgtggtgcgggcgctcggccagggccaggaccgcacggggcaaccg
ctgttccgggcgatggtcagcgaggagaacatgccggaggcgttcgacctcgcccccggg
ctgcgcgcggaccgcttcgacatccccaaccccaccgccaagttcgacctgaccctgttc
gtcgccgacagccccggcggcgcccggctgaccctcgaatacagcaccgaactgttcacc
gggcagaccgccgagcggctcctggacgcggtgctggcactgagccgcaacgccgtcaac
cacccggaccgggccctgtgcacgctgacggcggtgtcggtcgaggaccaggtccggctg
tcccgctggtcacgcggcgccgacgccgtggacggcggggccacggccctcgacctgttc
cacgcccgggcggccgacgccgccgggaccgtggccgtcgtggtgggcacgacccgggtc
acctacgccgaactcgaccaccgcgcgggccgcgtcgccgccgcactgctcgcggctggg
gtacgccccgggcaggtggtgggtgtgctgctgccgcgctcggtggacctcgtcgcggcg
atgctcggcgcctggaagtgcggagccgccttcctcgccctggacaccggccagcccgcc
gagcgcctggccgccctggtgcgggactcctcggccgccgtcgtcgtcggcaccggggag
cgggcccgggacgtggcgggcaccacccgtctcgtcgacgtcaccgacctgcccgagcac
ccggcgcccgggacgaccggcgcgggcgccgcggcgtacgtgctgtacacctccggatcg
accggccgccccaagggcgtcgtcgtgccgcaccagggcctcgccaactacctgcgctgg
gccgtcgacgcgtacggcgcgggacgcaccccggtggccccggtccactccagcgtggcg
ttcgacctcacggtgacgagcctgtgggtgccgctgatcgccggtggcacgatccacctc
gtggacgaggccgatccgctggacggactggtcgccgtggtgagcggcccggtccggccc
aacctgatcaagctcaccccctcccacctccaggccctctgccggctcatccccgagggc
ggcctcgcgggcctcgacgcctgcttcgtcgtcggcggtgaggcactgtcccccgtcctc
gtcgaccagttccgcgcggtcgcccccgacgcgacggtcgtcaacgagtacgggccgacc
gaaaccgtcgtcggctgctgtgtccacacgctcgccccgggcgaggccgtgcccgagcgt
cccggcatcccggcggggcggcccatcgcgggcacctcgctgtacgtcctggacgagcgc
atggcgcccgtgccggtgggggtgccgggcgagctctacatcggcggcacccaggtggcc
tggggctacctgggcgacggggcgaagacggccgccgtgttcgtgcccgacccgttcagc
tcggtccggggcgcccgcctgtaccgcaccggcgacctggtccgctacctccccaccggg
gagctggagttcctgggccggcgtgatcaccaggtcaagatccgtggtcagcggatcgag
ctcggcgaggtcgagaacgccctgcgcggcctgcccggcatcacggacgccgtcgtcatc
gcccgacccgacaccacgggcggcacggcgctcgtcggctacgcgacgggcagcgtcgac
ccggcggacgcccgcacggccctggcccggaccctgccggaggcgatgatcccggccacc
gtcgtcgtactcgccgagataccgctcacccccaacggcaaggtcgaccgggcggcgctt
ccggccccggacctgtcggtggcgcgggtggggtatcgggcgccggtgacgggggaggag
tgccggttggcggagttgttcgccgaggtgctgggtgtggagcgggtgggtttggacgat
gacttcttcacgctcggcggccactctctgctggccacccagctgattgcgcgtatccgt
tcggacttcggtgttcagcttccgttgcggacgttgttcgagagccctgtgttgggggtg
ttggccggggtggtggtgtcggcggggcgtgtgggtgcgttgccggagttggtgcgggtg
gatcgtggtggtgagttgccgttgtcgtttgctcagcagcggatgtggtttctgcatgag
ttggatccggaggggtcgttctacaacgttccggcggctgtgcggttgtcgggtgggttg
gatgtggggcgtttgcgtggtgcgttgatggtggtggcggggcggcacgaggtgttgcgg
acccggttcgtcgagggtgtggcgggtccggtgcaggttgtgggtgatgagccggcgatc
gagttcgtggtgcgtgatgtgtcgggtgtgggtgatccggatgctgtggcgttgggggct
gcgcgggatcttgccggtctgccgttcgatctggttgccggtccgttgatgcgggtggtg
gtgatgcgggtgcgtgagggcgagcatgttctggcgttgtcgatgcatcacatcgtgtcg
gacggttggtcggtcggggtgttgctgcgggagattcaggcggcgtatgcggggcgtgag
ttgccggatctggtggtgcagtacgcggattacgcggcgtggcagcgtagttggctgacc
ggtgatgtgctggaggagcagctggcctactggaggcatgagttggcgggtgcgccgtcg
gctctggatctgccgaccgaccggccgcggcccgcgacgccgagtcatcggggcgcccag
ctcaccgaagcactcgacgccatgacggtttcccggctggcggaggctgctcaggtccgg
ggaacgactctcttcagtgttctgcagtcggtgttggcggcggtgttgtcgcggcggtcg
ggtcagggtgatgtggtgatcggggtgccggtggcgaaccggtcgcgggtggagacggag
gatctgatcgggttcttcgtcaatacgttgccgctgcgtactcgggtggctgcgggtgat
tcgttcgaggagctgctggaccaggtgagccggacggctctggagggcttgtcgcatcag
gacgtgccgttcgaccggttggtccaggagcttgcgccggaccgtgaccgttcgcgcaat
ccgatcttccaggtgatgctcgcgttccagaacgcgccgaccggcgaagcggcccccggc
gacctcgacctgacctatctgccggtcggcgacgggaccgccaagttcgacctgatgctc
ctcgtggaggaggcggcaggcggcgaactgtccctggcgctggagtacagcacggacctc
ttcacggagcagaccgcccgcgcggtgctcgacgacatccagcgcgcgtgccgtgccgcg
gcggccgatcccgcatgccccgtcggagaactcgccccggtctccgagaaggagagcgag
atcctggccggttggaaccggacggaccgcgcggaccggctcgacagtctcgtcgcccgg
gtcagggagcatgcctccatccggccgggcgccgtcgcgctcactgatgaccacgggtcg
ctgacctatcgggagctggtggggcgggcgagtcgtgtcagccgtgagctgcttgccgcg
ggtgtcgtggctgatgaccgggtggccttccacggtgagcgtggtgcggacgcggtggtg
gcgttcctcgggattctgggggcgggtggtgcctatctgccgctggacccgaatgccccg
ctggcgcggaaggccgacatggtcaccgcctccggcgcccgcctcctcatcacgacagcc
ggccacacagccccgacccacgccatcgccaccgaagccggtacccaccccgacgtcctc
gtctgcccgactgcggccgacgcaccggaggagctcgtcccgctccgtgcgctggatggc
gatgatctggcgtatgtgctgtatacgtcgggttcgacggggcgtccgaagggggcgatg
gtccatcacgcggggatgaacaatcacctgttggcgaaggtggatgatctgggtttgacc
ggtggtgatgtgatcgcgcagaacgcggcgttgacgttcgacatctcggtgtggcagatg
accgccgctctggtgaccggtgggcggaccgcggtctacggggacgagacggcgcatcac
gcgacggagctgttcctgcgcgcggaccgggacgccgtgaccgttctcgaagtggttccc
tcgctcctgcgggcggctctggacgcgtgggacaccgtcgaggagtccgcccccgccctg
ccggtgctgcggaaactcgtcgtcacgggggaggcgctgccgccggatctgtgcacccgg
tggttcgcccgttatccggggatcgacgtcgtcaacgcctacggtcccaccgagtgctcc
gacgacgtcacccatgccaccctcaccccaggcacggagacccgtcacgcgcacatcccg
atcggcagcgccgtgcgcaacacccgtctctacgtcctggacgaggatctccggcccctg
cccgtcggcgtccggggtgaactcttcgtcgccggcaccggcgtcggccgcggttacctc
gacgatcccgcccgcacggcggcggccttcatccccgaccccttcagcaccacacccggg
gcgcgtctctacgccaccggtgacatcgcccgccaccttcccaccggggagctggagttc
ctgggccggcgtgatcaccaggtcaagatccgtggccagcgcatcgagctcggcgaggtc
gagaacgccctgcgcgacctgcccggcatcacggacgccgtcgtcatcgcccacaccgac
cccaacaaccagacccgtctcgccgcctacaccaccggccccctcctcccggcgcagacc
cgcaccgcactcgccaccaccctccccgaaaccctcatccccacccacatcaccaccctc
gacaccatgcccctcacccccaacggcaaggtcgaccgggcggcgcttccggccccggac
ctgtcggtggcgcgggtggggtatcgggcgccggtgacgggggaggagtgccggttggcg
gagttgttcgccgaggtgctgggtgtggagcgggtgggtttggacgatgacttcttcacg
ctcggcggccactctctgctggccacccagctgattgcgcgtatccgttcggacttcggt
gttcagcttccgttgcggacgttgttcgagagccctgtgttgggggtgttggccggggtg
gtggtgtcggcggggcgtgtgggtgcgttgccggagttggtgcgggtggatcgtggtggt
gagttgccgttgtcgtttgctcagcagcggatgtggtttctgcatgagttggatccggag
gggtcgttctacaacgttccggcggctgtgcggttgtcgggtgggttggatgtggggcgt
ttgcgtggtgcgttgatggtggtggcggggcggcacgaggtgttgcggacccggttcgtc
gagggtgtggcgggtccggtgcaggttgtgggtgatgagccggcgatcgagttcgtggtg
cgtgatgtgtcgggtgcgggtgatccggatgctgtggcgttgggggctgcgcgggatctt
gccggtctgccgttcgatctggttgccggtccgttgatgcgggtggtggtgatgcgggtg
cgtgagggcgagcatgttctggcgttgtcgatgcatcacatcgtgtcggacggttggtcg
gtcggggtgttgctgcgggagattcaggcggcgtatgcggggcgtgagttgccggatctg
gtggtgcagtacgcggattacgcggcgtggcagcgtagttggctgaccggtgatgtgctg
gaggagcagctggcctactggaggcatgagttggcgggtgcgccgtcggctctggatctg
ccgaccgaccggccgcggcccgcgacgccgagtcatcggggcgcccagctcaccgaagca
ctcgacaccccgaccgtcacccggctgaccgaggccgcccaacaacgcggcaccaccctt
ttcagtgttctgcagtcggtgttggcggcggtgttgtcgcggcggtcgggtcagggtgat
gtggtgatcggggtgccggtggcgaaccggtcgcgggtggagacggaggatctgatcggg
ttcttcgtcaatacgttgccgctgcgtactcgggtggctgcgggtgattcgttcgaggag
ctgctggaccaggtgagccggacggctctggagggcttgtcgcatcaggacgtgccgttc
gaccggttggtccaggagcttgcgccggaccgtgaccgttcgcgcaatccgatcttccag
gtgatgctcgcgttccagaacgcgccgaccacccaaacggcccccggcgacctcgacctg
acctatctgccggtcggcgacaccacggccaagttcgacctgatgctcctggccgaggag
acctccggcggtgagctcgccctcgtactggagtacagcaccgacctcttcacggagcag
accgcccgggcggtgctcgacgacatccagcgcgcgtgccgtgccgccgcggccgatccc
gcatgccccgtcggagaactcgccccggtgtcccagagggaggacgaccttctgcgcacc
tggaaccggaccgaccgctccgaccgactggactccctggtcgcccgggtcagggagcat
gcctccatccggccgggcgccgtcgcgctcactgatgaccacgggtcgctgacctatcgg
gagctggtggggcgggcgagtcgtgtcagccgtgagctgcttgccgcgagtgtcgtggct
gatgaccgggtggccttccacggtgagcgtggtgcggacgcggtggtggcgttcctcggg
attctgggggcgggtggtgcctatctgccgctggacccgaacgccccgctggcgcggaag
gccgacatggtcaccgcctccggtgcccgcctcctcatcacgacagccggccagaccgag
cagacccacgccatcgccaccgaagccggccgcaccgccgggaccggaactgtcacctcg
gaagccgggaccccgcccacggtcctcgtctgcccgactgcggccgacgcaccggaggag
ctcgttccggaccggatcacgcatggtgatgatctggcgtatgtgctgtatacgtcgggt
tcgacggggcgtccgaagggggcgatggtccatcacgcggggatgaacaatcacctgttg
gcgaaggtggatgatctgggtttgaccggtggtgatgtgatcgcgcagaacgcggcgttg
acgttcgacatctcggtgtggcagatgaccgccgctctggtgaccggtgggcggaccgcg
gtctacggggacgagacggcgcatcacgcgacggagctgttcctgcgcgcggaccgggac
gccgtgaccgttctcgaagtggttccctcgctcctgcgggcggctctggacgcgtgggac
accgtcgaggagtccgcccccgccctgccggtgctgcggaaactcgtcgtcacgggggag
gcgctgccgccggatctgtgcacccggtggttcgcccgttatccggggatcgacgtcgtc
aacgcctacggtcccaccgagtgctccgacgacgtcacccatgccaccctcaccccaggc
acggagacccgtcacgcgcacatcccgatcggcagcgccgtgcgcaacacccgtctctac
gtcctggacgaggatctccggcccctgcccgtcggcgtccggggtgaactcttcgtcgcc
ggcaccggcgtcggccgcggttacctcgacgatcccgcccgcacggcggcggccttcatc
cccgaccccttcagcaccacacccggggcgcgtctctacgccaccggtgacatcgcccgc
caccttcccaccggggagctggagttcctgggccggcgtgatcaccaggtcaagatccgt
ggccagcgcatcgagctcggcgaggtcgagaacgccctgcgcgacctgcccggcatcacc
gatgccgtcgtcatcgcccacaccgaccccaacaaccagacccgtctcgccgcctacacc
accggccccctcctcccggcgcagacccgcaccgcactcgccaccaccctccccgaaacc
ctcatccccacccacatcaccaccctcgacaccatgcccctcacccccaacggcaaaatc
gaccgagccgcactgcccacaccggacctcaccttcgaacgcaccccctaccgggccccc
ggcacgctggaggagaggctgctcgccgagctgttcgccgaggtgctgggcgtcgaggaa
gtgggcctggacgacgacttcttcaccctcggcggccactccctcctcgccacccagctc
atcgcccgcatccgctccgacttcggcgtccagctccccctgcgcaccctcttcgaaacg
cccgcactcgaacccctggccgccgaggtcaccgctctcatcgccgagggcgcccacgac
ggtggacacaccgcgggcgtcgagacgctcctcgcggagatcgagcacctctccgacgaa
gaggtcgaagcactcctctccggctccgccgcgtcggccgccggacccgcacaggtcgca
tcggccgccggacccgcacaggtcgcaccggccgccggacccgcacaggtcgcaccggcc
gcccgacccgtacaggtccagccggcagccggacccgcgccggccgccggacccgttccc
ggacgcccggcgcccggcgccgacgcccaccgcccgacgcacgcctccacccgactctga

DBGET integrated database retrieval system