KEGG   Streptomyces griseus: SGR_2592Help
Entry
SGR_2592          CDS       T00691                                 

Definition
(GenBank) putative cystathionine beta-synthase
  KO
K21949  
N-(2-amino-2-carboxyethyl)-L-glutamate synthase [EC:2.5.1.140]
Organism
sgr  Streptomyces griseus
Brite
Enzymes [BR:sgr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.140  N-(2-amino-2-carboxyethyl)-L-glutamate synthase
     SGR_2592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3065412..3066395)
Genome map
AA seq 327 aa AA seqDB search
MNPLRKRLDMIGASVGRTPLLWLPDDSLSLFAKLESVNPNGSTKDRSAYWILKKAIERGD
ITENTTVVESSSGNFATSLAVFCQSLGIRFVPVIDANCNALTEAVLRSCCERVEKVVAPE
GAALLPARLARVAELRAEISDVYWPNQYANGDAADAHYQLTGGELSSAFSRIDYLFVGVG
TGGTIAGLSRRVKDQFPGATVVAVDVHGSVALGGAPGKRHIPGLGSSMVPPLLDQALIDH
VMHVSEYETVIGCRTLYAEHGLYAGGSTGSVYAAIGRYFAEHPVPPGERPTAVFLCADRG
IPYARTVYDLDWVERTLAPDAVATAAL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgaacccactgcgcaaacgcctcgacatgatcggcgcctccgtgggccgcaccccgctc
ctctggctgccggacgacagcctgagcctgttcgcgaaactggagtcggtcaatcccaac
ggcagcaccaaggaccgctccgcgtactggatcctcaagaaggccatcgagcgcggcgac
atcacggagaacaccaccgtcgtcgagtcctcgtcggggaacttcgcgacctcgctcgcc
gtcttctgccagtccctgggtatccggttcgtccccgtcatcgacgccaactgcaacgcc
ctgaccgaggccgtcctgcgctcgtgctgcgagcgggtcgagaaggtcgtcgccccggag
ggcgccgccctgctgcccgcccgtctcgcgcgggtcgccgagctccgtgcggagatcagc
gacgtctactggcccaaccagtacgccaacggcgacgccgcggacgcccactaccagctg
accggcggcgagctgagcagcgcgttctcccgcatcgactacctcttcgtcggggtcggc
accggcggcaccatcgccgggctgtcccgacgcgtcaaggaccagttccccggcgccacc
gtcgtcgccgtcgacgtccacggctccgtcgccctcggcggcgcccccggcaagcggcac
atccccggactcggttcgagcatggtgccgcccctcctcgaccaggccctcatcgaccac
gtcatgcacgtcagcgagtacgagaccgtgatcggctgccggaccctgtacgccgaacac
ggcctgtacgcgggcggatccaccggcagcgtctacgccgcgatcggccggtacttcgcc
gagcacccggtgccccccggcgagcggcccaccgccgtcttcctctgcgccgaccggggc
atcccctacgcccggaccgtctacgacctggactgggtggaacgcaccctcgcccccgac
gccgtggccacggccgcgctctga

DBGET integrated database retrieval system