KEGG   Streptomyces griseus: SGR_2597Help
Entry
SGR_2597          CDS       T00691                                 

Definition
(GenBank) putative M28-family peptidase
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M28 Peptidase_M20 Peptidase_M42 AfaD
Motif
Other DBs
NCBI-ProteinID: BAG19426
Kitasato: SGR2597
UniProt: B1W2R2
Position
complement(3076833..3079262)
Genome map
AA seq 809 aa AA seqDB search
MTTTTSAQVKVDPAGPGDAPGAGPAKAPAPGRRTPALLVALALVALLGTLATLALRPPPA
KGTDAPRAEFSAARAAGHLTEIARRPHPLGSAEHTRVRDYLVATARALGAEVEVRSGEVA
QPDMGSPIPAATVHNVVARLPGTGGPDSRGDGKALLLVAHYDSVPNGPGAADNGAAVAAL
LETLRALKESGGVRNDVVLLFTDGEELGALGAEFFVRDHGLDEFGAVLNWEARGSGGPLM
MFETGEGNLPLIDAFAEANPRPVANSLAYEVYKHLPNDSDFTVFRDEGVAGLNSAFIEGF
HDYHSRSDTVEQLDRDSVQHHGDAMLGMVRALDGADADDFRGANAVYFDLFARVLVHYPA
TWAPPLAGVTLALLGGLLGWAVRRFALRPRQLAAAAGVALGAPVAAGGVAHGLWTLALLL
APDLAALPLAEPYGRGWFVAAFGAVVGGVLLGAARLLRRFRPAEAAGGVLIFAGLLLAVL
TLVLPGAGYLVQWPLLAALPALWWTCRTRERAKGEGPPGGREAWTGALLWSAGPAVAAVL
FVPLTGSLLTALGIPLGSVAVVFVTAGAVSALPLLAGLPANGRSAAVAAGLALALLGTGV
AGEGFGPGRPRPDSLLYVRDDVTGEALWFSADPAPDAWTRRVLGDDPRRAPVSDYFPPRG
DEPAMVAKAPRLDIPRPTVTVVDDRTGGGTRTVRFRAASQRPAWRIQVRLEREPLAACTV
AGTRLDRAALEEQTGGAEDVVFHHYGARGFDISCEVPAGTRLAVDVADFTLGLTSHVSEL
VGPRPRDTVPVAFGFLPEDSVIARTTETI
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccacgacctctgcccaggtgaaggtggacccggccggtcccggggacgctccg
ggggccgggcccgccaaggcccccgcccccggccggcgcaccccggctctgctcgtcgcg
ctggcactcgtcgcgctgctcggcacgctggccacactggcgctgcgtccgccgcccgcg
aagggcacggacgcgccgcgagccgagttctcggcagcacgcgccgccggacacctcacc
gagatcgcccgccggccgcacccgctcggcagcgccgagcacaccagggtccgcgactac
ctcgtggcgacggcgcgggcgctcggggcagaggtcgaagtccggtcgggcgaggtggcg
cagcccgacatgggcagccccatccccgcggcgaccgtgcacaacgtcgtcgccagactg
cccggcaccggcgggccggacagcaggggcgacgggaaggcgctgctgctggtggcgcac
tacgactccgtgccgaacgggccgggagcggcggacaacggagcggcggtcgcggccctc
ctggagacgctgcgcgccctgaaggagtccgggggtgtacgcaacgacgtggttctcctg
ttcacggacggggaggaactcggcgccctgggggccgagttcttcgtacgggaccacggt
ctcgacgagttcggcgcggtgctcaactgggaggcgcgcggcagcggcggcccgctgatg
atgttcgagaccggcgagggaaaccttccgctgatcgacgccttcgccgaggccaacccg
cgcccggtggccaactccctggcgtacgaggtctacaagcacctgcccaacgacagcgac
ttcaccgtcttccgcgacgagggcgtggcggggctgaactccgccttcatcgaggggttc
cacgactaccactcgcgctccgacacggtcgaacagctcgaccgcgacagcgtgcagcac
cacggcgacgccatgctcggcatggtccgggccctggacggcgccgacgccgacgacttc
cggggcgcgaacgcggtctacttcgacctgttcgcccgtgtcctcgtgcactacccggcg
acctgggcgccgcctctggcgggggtgacgctggcgctgctcggcggcctgctggggtgg
gcggtacgccgcttcgccctgcggccccggcagctcgcggcggcggcgggggtggccctc
ggcgcgccggtggcggcgggcggcgtggcccacgggctgtggaccctcgccctgctgctc
gctcccgacctggccgcgcttcccctggccgaaccgtacggacggggctggttcgtggcg
gcgttcggcgccgtcgtgggcggggtgctcctcggggcggcccggttgctgcgccggttc
cgtccggccgaggcggcgggcggggtgctgatcttcgccgggctgctgctcgcggtgctc
accctcgtactgcccggcgccggctacctcgtgcagtggccgctgctcgccgcgctgccc
gcactgtggtggacctgccggacccgggagcgggcgaagggcgaggggcctcccgggggg
cgggaggcgtggaccggggccctgctgtggtcggccgggccggccgtggccgccgtcctc
ttcgtgccgctcaccggcagtctgctgacggcgctcggcattccgctcggctcggtggcc
gtggtctttgtgacggccggcgcggtgtcggccctgccgctcctggccgggctccccgcg
aacggccggagcgccgccgtcgcggccggcctcgccctggccctgctcggcacgggcgtc
gccggggaagggttcggcccggggcggccacggcccgactcgctgctgtacgtgcgtgac
gacgtgaccggcgaggccctgtggttcagcgcggacccggcccccgacgcctggacgcgc
cgggtgctcggcgacgatccgcggcgggcccccgtgagcgactacttcccgccgcgcggc
gacgagccggcgatggtggcgaaggcgccccgcctcgacatcccccggccgacggtcacg
gtcgtcgacgaccgcaccggcggcggcacccgcacggtccgcttccgggccgcgtcgcag
cggccggcctggcggatccaggtgcggctggagcgcgaaccactggccgcctgcacggtc
gcgggcacccgcctggaccgggcggccctggaggagcagacggggggcgcggaggacgtc
gtcttccaccactacggagcacgcggcttcgacatcagctgcgaggtcccggccggcacc
cggctcgcggtggacgtcgcggacttcaccctcggcctgacctcccacgtgtcggagctg
gtggggccgcgaccgcgggacaccgtcccggtggcgttcggctttctgccggaggactcc
gtcatagcccgtacgacggaaacgatctga

DBGET integrated database retrieval system