KEGG   Streptomyces griseus: SGR_2600Help
Entry
SGR_2600          CDS       T00691                                 

Definition
(GenBank) hypothetical protein
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAG19429
Kitasato: SGR2600
UniProt: B1W2R5
Position
3081187..3081402
Genome map
AA seq 71 aa AA seqDB search
MADLAQTAPAPPDPLARAQLSGLLTTLCLLQAADLPADAGRRLSLLRKARSHARTTTVLT
AYLLNDSTFRR
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
ttggcggacttggcccagaccgcccccgcaccgcccgatccgctggcccgcgcccagctc
agcgggctgctcacgaccctctgcctcctgcaggcggcggacctcccggcggacgccgga
cgccgtctcagcctgctccgcaaggcgcgcagccatgcccgcacgaccaccgtgctcacc
gcgtacctgctcaacgactcgaccttccgccgctga

DBGET integrated database retrieval system