KEGG   Streptomyces griseus: SGR_2602Help
Entry
SGR_2602          CDS       T00691                                 

Definition
(GenBank) putative hydrolase
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Abhydrolase_4 Thioesterase Abhydrolase_5 Ser_hydrolase Esterase Ndr FSH1 PGAP1
Motif
Other DBs
NCBI-ProteinID: BAG19431
Kitasato: SGR2602
UniProt: B1W2R7
Position
3082306..3083250
Genome map
AA seq 314 aa AA seqDB search
MTWTERRFARNGAVELAHDRLREGADGEPLLLVMGLAVSRHWWPGELCAAFADAGFAVAR
YDQRDAGESTRLPKRAARGNPFTALAAGRGAAYTAEDMADDAVAVMDALGWQSAHLFGHS
LGGVVAQRVALRHPGRVRTLTSSAALPSDVGGLGAFRHLRLGTLAKFARVKPARDREERI
AAGLAVARLVASPGYPFDEAEALERITADVDTGIADPDAQSRQIGAPWSGPSLAELRVPA
LVLHGTDDPLLKPSAGRATAAAIHGARLVLQPGVGHDIPRERHTAVAAELRALADRAPGS
TTARDGLPGPEGPA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacctggaccgaacgccgcttcgcccgcaacggtgcggtcgagctcgcccacgaccgg
ctccgggaaggcgcggacggcgagccgctgctcctggtgatgggtctcgcggtctcccgg
cactggtggcccggggagctgtgcgcggccttcgccgacgccggattcgccgtcgcccgc
tacgaccagcgggacgcgggcgagtccacccggctgccgaagcgcgccgcgcggggcaac
cccttcaccgccctggccgccggccgcggtgcggcctacaccgccgaggacatggccgac
gacgccgtcgccgtcatggacgcgctgggctggcagtcggcacacctcttcgggcactcg
ttgggcggcgtcgtcgcccagcgcgtcgccctgcgccaccccggccgggtgcgcacgctc
acctcgtccgccgcgctccccagcgacgtcggcggcctgggcgcgttccgccatctgcga
ctcggcacgctcgcgaagttcgcccgcgtcaagcccgcccgggaccgggaggagcggatc
gcggccgggctcgccgtagcccggctcgtcgcctcccccggctacccgttcgacgaggcg
gaggccctggagcggatcaccgccgacgtggacaccggcatcgccgacccggacgcccag
tcccgccagatcggggcgccctggagcggcccttccctcgccgaactgcgcgtccccgcg
ctggtgctgcacggcacggacgaccccctgctcaagccctcggcgggccgggccaccgcc
gcggcgatccacggcgcccggctcgtcctccagcccggtgtcggccacgacatcccgcgc
gagcggcacaccgccgtcgccgccgagctgcgggcactcgcggaccgggcccccggatcg
acgaccgcccgtgacgggcttcccgggcccgagggtcccgcgtga

DBGET integrated database retrieval system